Abbreviation
Recombinant Human papillomavirus type 16 E7 protein
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 μg/mL can bind Biotinylated MYC(CSB-EP015270HU-B), the EC50 is 268.1-354.3 ng/mL.
Research Area
Microbiology
Alternative Names
Protein E7
Molecular Characterization
Species
Human papillomavirus type 16
Target Protein Sequence
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 μg/ml can bind Biotinylated MYC(CSB-EP015270HU-B), the EC50 is 268.1-354.3 ng/mL.
Description
HPV16 E7 oncoprotein drives cervical carcinogenesis through its interaction with tumor suppressors and transcriptional regulators, making validated binding activity essential for mechanistic studies. This full-length recombinant construct (aa 1–98), expressed in *E. coli* with dual N-terminal and C-terminal 6xHis tags, demonstrates confirmed protein–protein interaction capability: immobilized at 10 μg/mL, it binds biotinylated MYC with an EC50 of 268.1–354.3 ng/mL in functional ELISA. This quantitative binding profile supports use in interaction screening assays, competition ELISAs, and as a positive control in antibody development campaigns targeting the E7–host protein interface. The preparation meets greater than 90% purity by SDS-PAGE, providing a suitable basis for binding kinetics studies and pull-down experiments where consistent stoichiometry matters, though researchers planning cell-based assays should note that endotoxin levels have not been tested.