Abbreviation
Recombinant Human VTN protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤1 EU/mg by the LAL method
Activity
Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2-10 μg/mL.Optimal concentration depends on cell type as well as the application or research objectives.
Alternative Names
Vitronectin; VN; S-Protein; Serum-Spreading Factor; V75; VTN
Species
Homo sapiens (Human)
Expression Region
20-478aa
Target Protein Sequence
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
Vitronectin mediates cell adhesion, migration, and matrix remodeling through integrin and urokinase plasminogen activator receptor interactions, making it a critical component in wound healing, cancer invasion, and fibrosis models. This full-length mature protein (aa 20–478) demonstrates functional activity with an ED50 of 2–10 μg/mL in supporting NIH3T3 fibroblast adhesion, providing a quantitative benchmark for optimizing cell attachment assays and 3D culture scaffold coatings. Mammalian expression preserves the native glycosylation patterns essential for proper integrin binding, enabling researchers to study physiologically relevant receptor interactions in cancer invasion models and matrix remodeling experiments. The combination of >95% purity and ≤1 EU/mg endotoxin satisfies the quality criteria typical for integrin-binding assays, antibody validation workflows, and primary cell culture applications where low endotoxin levels are critical for maintaining cell viability and preventing inflammatory artifacts.