Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human EphB2 in functional ELISA is less than 20 ug/ml.
Research Area
Signal Transduction
Alternative Names
VAPB; UNQ484/PRO983; Vesicle-associated membrane protein-associated protein B/C; VAMP-B/VAMP-C; VAMP-associated protein B/C; VAP-B/VAP-C
Species
Homo sapiens (Human)
Expression Region
2-132aa
Target Protein Sequence
AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 100mM NaCl, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
Introducing Recombinant Human VAPB, a high-quality protein engineered for signal transduction research. This partial protein spans the 2-132aa expression region of Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C), a critical component in cellular communication and regulation. Produced in E. coli and featuring a C-terminal 6xHis-tag for convenient purification, Recombinant Human VAPB offers a reliable and effective solution for researchers seeking to study VAMP-B/VAMP-C protein.
Our Recombinant Human VAPB maintains a purity of greater than 90%, as determined by SDS-PAGE, ensuring that it will deliver consistent performance in your experiments. Moreover, the endotoxin levels are less than 1.0 EU/µg, as measured by the LAL method, ensuring minimal interference with your research. The biological activity of this protein is confirmed by its ability to bind Human EphB2 in functional ELISA, with an ED50 of less than 20 µg/ml, demonstrating a high level of activity.
Available as a lyophilized powder, Recombinant Human VAPB provides convenient storage and use for various experimental designs. Choose this protein for a dependable and effective resource for your signal transduction research needs.