Recombinant Human V-set and immunoglobulin domain-containing protein 4 (VSIG4), partial (Active)

In Stock
Code: CSB-MP896869HU
Size:
20ug
20ug100ug1mg
US$98
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human VSIG4 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ mL can bind Anti-VSIG4 recombinant antibody (CSB-RA896869MA1HU), the EC50 is 51.14-68.73 ng/mL.
Target Names
VSIG4
Uniprot NO.
Alternative Names
(Protein Z39Ig)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
20-283aa
Target Protein Sequence
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.6 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody (CSB-RA896869MA1HU), the EC50 is 51.14-68.73 ng/mL.
  • The purity of VSIG4 was greater than 90% as determined by SEC-HPLC
Description

VSIG4 functions as a complement receptor on macrophages and has emerged as a key negative regulator of T cell activation, positioning it alongside established immune checkpoint targets such as PD-L1 and TIGIT. This recombinant human VSIG4 construct covers the extracellular region (aa 20–283), encompassing both the IgV and IgC domains critical for ligand engagement, and is expressed in mammalian cells to preserve native glycosylation and conformational integrity essential for receptor-ligand interaction studies. Functional ELISA validation confirms robust binding activity, with an EC50 of 51.14–68.73 ng/mL against an anti-VSIG4 recombinant antibody, supporting use in blocking antibody screening, therapeutic antibody epitope mapping, and affinity characterization by SPR or BLI. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based immune checkpoint assays and small-molecule or biologic inhibitor screening in drug discovery workflows.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases.
Gene References into Functions
  1. Soluble VSIG4 levels are associated with the progression and recurrence of ovarian cancer, indicating that soluble VSIG4 may be used as a potential biomarker for predicting tumor prognosis. PMID:28498255
  2. VSIG4 signaling provides an anti-immune evasion mechanism that prevents the outgrowth of intracellular bacteria in macrophages PMID:27440002
  3. The VSIG4 upregulation by LMP1 was regulated at the transcriptional level via the NF-kB signaling axis. PMID:28859984
  4. VSIG4 expression is significantly upregulated in human masticatory mucosa during wound healing PMID:28005267
  5. we concluded that let-7g-5p inhibits epithelial-mesenchymal transition (EMT) consistent with reduction of glioma stem cell (GSC) phenotypes by targeting VSIG4 in glioblastoma. PMID:27634309
  6. Data indicate that rotein kinase calpha (PKCalpha) plays a role in downregulating complement receptor Ig (CRIg coded by V-set and Ig domain-containing protein 4 VSIG4) expression. PMID:25687755
  7. complement receptor of the immunoglobulin superfamily-L-factor H protects glomerular mesangial cells from complement-mediated injury and proliferative lesions PMID:25114177
  8. we identified VSIG4 as a potential diagnostic marker of severe preeclampsia. The determination of this gene may improve the prognostic assessment of severe preeclampsia. PMID:24349325
  9. Data indicate that massive V-set and Ig domain-containing 4 VSIG4(+) cell infiltration throughout the non-small-cell lung cancer samples. PMID:24862966
  10. we showed that a complement receptor of the Ig superfamily (CRIg, also known as Z39Ig), a receptor for complement fragments (C3b and iC3b), was expressed on a subset of intestinal macrophages in murine and human large intestine PMID:21768202
  11. These results suggest that T cells can opposite T cell hyporesponsiveness through dampening Z39Ig inhibitory signals from macrophages and thus maintain their anti-viral function in chronic hepatitis B. PMID:20399148
  12. hVSIG4 recombinant adenovirus-transfected DCs suppress T cell proliferation, cytokine production and activation marker expression with PMID:19914289
  13. Results report the identification and characterization of a Complement Receptor of the Immunoglobulin superfamily, CRIg, that binds complement fragments C3b and iC3b. PMID:16530040
  14. These data indicate that the macrophage Z39Ig is involved in the pathogenesis of inflammatory diseases through chemokine induction, which will promote the migration of inflammatory cells into the lesion area, and MMP-9 induction. PMID:16882875
  15. The specific expression of VSIG4 on resting macrophages suggests that VSIG4 may be important for the maintenance of T cell unresponsiveness in healthy tissues. PMID:17016562
  16. CRIg is not only a phagocytic receptor, but also a potent inhibitor of the alternative pathway convertases PMID:17051150

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Abundantly expressed in several fetal tissues. In adult tissues, highest expression in lung and placenta. Expressed in resting macrophages.
Database Links

HGNC: 17032

UNIGENE: Hs.8904

KEGG: hsa:11326

STRING: 9606.ENSP00000363869

OMIM: 300353

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products