Home
Product
Protein
Active Protein
Other
Recombinant Human UL16-binding protein 2 (ULBP2), partial (Active)

Recombinant Human UL16-binding protein 2 (ULBP2), partial (Active)

In Stock Discontinued

Code: CSB-AP005521HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg(1mg*1 or 500ug*2)

US$184

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal hFc-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to bind Human ULBP-2 in functional ELISA is less than 30 ug/ml.

Target Names

ULBP2

Uniprot NO.

Q9BZM5

Research Area

Immunology

Alternative Names

ALCAN alpha; ALCAN-alpha; N2DL 2; N2DL-2; N2DL2; N2DL2_HUMAN; NKG2D ligand 2; NKG2D ligand 2 precursor; NKG2DL2; RAET1H; Retinoic acid early transcript 1 H; Retinoic acid early transcript 1H; UL16 binding protein 2; UL16-binding protein 2; ULBP2

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

26-217aa

Target Protein Sequence

GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

51.4 kDa

Protein Length

Partial

Tag Info

C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Discover the power of Recombinant Human ULBP2, a high-quality protein engineered for immunology research applications. This partial-length protein encompasses the 26-217aa expression region of UL16-binding protein 2, a crucial component in the immune system's intricate network. Produced in mammalian cells and featuring a C-terminal Fc-tag for simplified purification, Recombinant Human ULBP2 is perfect for researchers seeking a dependable source of ULBP2 protein.

Our Recombinant Human ULBP2 exhibits a purity of greater than 90% as verified by SDS-PAGE, ensuring the protein will deliver optimal performance in your experiments. Furthermore, the endotoxin levels are less than 1.0 EU/µg as determined by the LAL method, guaranteeing minimal interference with your work. The activity of this protein has been assessed by its ability to bind Human ULBP-2 in functional ELISA, with an ED₅₀ of less than 30 µg/ml, demonstrating a high level of biological activity.

Supplied as a lyophilized powder, Recombinant Human ULBP2 offers convenient storage and use for a variety of experimental setups. Choose this protein for a reliable and effective solution for your research needs.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.

Gene References into Functions

High ULBP2 expression is associated with lymphoma. PMID:27477692
IMP3 directly interacts with ULBP2 mRNA, leading to ULBP2 transcript destabilization and reduced ULBP2 surface expression and indirectly downregulates MICB with a mechanism functionally distinct from that of ULBP2. PMID:26982091
By suppressing AR and up-regulating ULBP2 in HCC, cisplatin could up-regulate cytotoxicity of NK cells to better target HCC. PMID:26805759
human tumor cells lost their surface expression of ULBP2, but not ULBP1 and ULBP3, during NK cell-mediated cytolysis. PMID:24614922
This study suggests that NKG2D ligands shedding of MICA, MICB and ULBP-2 is a novel pathway in endometriosis complex pathogenesis that impairs Natural Killer Cells cell function. PMID:25775242
A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2. PMID:25983110
NKG2D and NKG2DL are involved in allergen-induced activation of dendritic epidermal T cells and the NKG2D/NKG2DL pathway might be a potential target for treatment of contact hypersensitivity. PMID:25634359
Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells. PMID:25212604
Data inticate that heat shock protein 60 (HSP60) interacted constitutively with NKG2D ligand ULBP2 and phosphatase of regenerating liver 3 (PRL-3) regulated HSP60 tyrosine phosphorylation. PMID:25687758
Results suggest that ULBP2 is expressed and released from cervical cancer cells by CRF, which regulates NKG2D expression in natural killer cells. PMID:24841552
c-Cbl regulates MICA- but not ULBP2-induced NKG2D down-modulation in human NK cells. PMID:24846123
the NKG2D ligand ULBP2 is transported to the cell surface through an endosomal pathway dependent on protein kinase C and lysosomal integrity. ULBP2 surface transport is dependent on the invariant chain. PMID:25024379
Vpr augments ULBP2 expression on both infected and uninfected bystander cells during HIV-1 infection of primary CD4+ T lymphocytes. PMID:23726848
Study shows that tumor-suppressive miR-34a and miR-34c act as ULBP2 repressors. Findings also implicate p53 in ULBP2 regulation, emphasizing the role of the specific NKG2DL in tumor immune surveillance. PMID:22102694
Data show that VSV infection caused an active suppression of NKG2D-ligand surface expression, affecting both endogenous and histone deacetylase (HDAC)-inhibitor induced MICA, MICB and ULBP-2 expression. PMID:21857986
Findings define the involvement of p53 in the regulation of ULBP1 and ULBP2 which enhance NK cell-mediated target recognition. PMID:21764762
analysis of the area under receiver operating characteristic curves showed that ULBP2 was superior to CA 19-9 in discriminating patients with early-stage PC from healthy controls PMID:21625447
The human NKG2D ligand ULBP2 can be expressed at the cell surface with or without a GPI anchor and both forms can activate NK cells PMID:21224393
Data show that IL-32alpha stimulates Fas and ULBP2 expression via activation of p38 MAPK, which increases NK susceptibility of chronic myeloid leukemia cells. PMID:21321117
it was shown that high expression of several NKG2D ligands is inversely correlated with ovarian cancer survival PMID:20054857
Levels of soluble ULBP2 were significantly increased in B-cell chronic lymphocytic leukemia. PMID:20428196
ULBP2 binds to the NKG2D receptor and activates multiple signaling pathways in primary natural killer cells. PMID:11777960
Human cytomegalovirus induces the expression of ULBP2, which is predominantly localized in the endoplasmic reticulum of infected fibroblasts together with viral protein UL16. PMID:12847260
These findings identify NKG2D ligands as targets of leukemia differentiation therapy PMID:17391757
IL-18 treatment increased ULBP2 expression in leukemia cells at the mRNA and protein levels PMID:18706445
ULBP2 was seen on 82.9% of ovarian cancer cells but not on normal ovarian epithelium. Strong expression of ULBP2 in these cells correlated with less intraepithelial infiltration of T cells & may relate to T cell dysfunction in the tumor microenvironment. PMID:18791713
IFN-gamma, by down-regulating ligand expression, might facilitate escape of MHC class I-negative melanoma cells from NKG2D-mediated killing by NK cells. PMID:19089914
administration of ATRA or sodium valproate to patients affected with acute myeloid leukaemia M3 or M1 respectively, leads to the induction of transcription and expression of NKG2D-L at the surface of leukaemic cells. PMID:19151770
RAET1G, like ULBP2, appears broadly expressed, but exhibits a lower apparent avidity for NKG2D due to a mutation in the center of the MHC-like fold. PMID:19424970
Data show upon HSV-1 infection of cell lines, surface levels of NKG2D ligands MICA antigen and UL16 binding protein 2 were downmodulated due to late viral ICP0 gene product(s). PMID:19508374
Only sULBP2 is an independent predictor of prognosis, the significance of which is superior to the well-established and widely used melanoma serum marker S100B. PMID:19671853