Abbreviation
Recombinant Human CD40 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L (CSB-MP004937HU3), the EC50 is 3.112-3.858 ng/ml.②Human CD40 protein hFc tag (CSB-MP004936HU1) captured on COOH chip can bind Human CD40L protein hFc and Flag tag (CSB-MP004937HU3) with an affinity constant of 2.06 nM as detected by LSPR Assay.
Alternative Names
CD40; TNFRSF5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
21-193aa
Target Protein Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L (CSB-MP004937HU3), the EC50 is 3.112-3.858 ng/ml.
-
Activity
Human CD40 protein hFc tag (CSB-MP004936HU1) captured on COOH chip can bind Human CD40L protein hFc and Flag tag (CSB-MP004937HU3) with an affinity constant of 2.06 nM as detected by LSPR Assay.
-
The purity of CD40 was greater than 95% as determined by SEC-HPLC
Description
CD40–CD40L interaction drives B cell activation, germinal center formation, and isotype switching, making precise characterization of this axis essential for immunology and therapeutic antibody development. This recombinant human CD40 construct spans the extracellular ligand-binding domain (aa 21–193) with a C-terminal hFc tag, and LSPR analysis confirms a KD of 2.06 nM against CD40L, demonstrating conformational integrity that supports SPR/BLI affinity characterization, blocking antibody screening, and epitope mapping studies. Functional ELISA further validates ligand engagement, with an EC50 of 3.112–3.858 ng/mL when binding CD40L, providing a reliable positive control for receptor-ligand interaction assays and small-molecule inhibitor screening. Mammalian cell expression preserves native glycosylation and folding, while purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg satisfy criteria typical for cell-based functional assays and drug discovery workflows.