Abbreviation
Recombinant Human TNFRSF11B protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 (CSB-MP023986HU1(F2)) at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml.
Alternative Names
(Osteoclastogenesis inhibitory factor)(Osteoprotegerin)(OCIF)(OPG)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
22-401aa
Target Protein Sequence
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-Flag-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 (CSB-MP023986HU1(F2)) at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml.
Description
TNFRSF11B (osteoprotegerin) serves as a soluble decoy receptor for RANKL, making it a critical regulator of osteoclastogenesis and a target of growing interest in cancer-associated bone remodeling research. This recombinant human TNFRSF11B covers the full-length mature protein (aa 22–401) and carries a C-terminal hFc1-Flag tag, produced in mammalian cells to preserve native folding and proper disulfide bond formation essential for accurate ligand engagement. Functional ELISA confirms robust RANKL-binding activity with an EC50 of 2.651–7.646 ng/ml against immobilized TNFSF11, providing a reliable positive control for receptor-ligand interaction assays and supporting use in competitive inhibition studies, blocking antibody screening, and affinity characterization by SPR or BLI. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality thresholds commonly required for drug discovery workflows targeting small-molecule or biologic inhibitors of the RANKL–OPG axis.
