Abbreviation
Recombinant Human TNFSF13 protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/mL can bind Human TNFRSF17 protein (CSB-MP023974HU1-B). The EC50 is 0.8083-0.9391 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein (CSB-MP6427MOV) at 2 μg/mL can bind Human TNFSF13 protein. The EC50 is 11.13-18.97 ng/mL.
Alternative Names
Tumor necrosis factor ligand superfamily member 13; A proliferation-inducing ligand (APRIL); TNF- and APOL-related leukocyte expressed ligand 2 (TALL-2); TNF-related death ligand 1 (TRDL-1); CD256; TNFSF13; APRIL, TALL2, ZTNF2; UNQ383/PRO715
Species
Homo sapiens (Human)
Expression Region
105-250aa
Target Protein Sequence
AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein of Isoform Alpha
Tag Info
N-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/ml can bind Human TNFRSF17 protein (CSB-MP023974HU1-B). The EC50 is 0.8083-0.9391 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein (CSB-MP6427MOV) at 2 μg/ml can bind Human TNFSF13 protein. The EC50 is 11.13-18.97 ng/mL.
Description
APRIL (TNFSF13) plays a central role in B cell survival and plasma cell differentiation by engaging BCMA (TNFRSF17) and TACI (TNFRSF13B), making it a key target in autoimmune disease and multiple myeloma research. This mammalian-expressed protein, spanning the full-length mature sequence (aa 105–250 of isoform alpha), demonstrates robust receptor binding with an EC50 of 0.8083–0.9391 ng/mL for human BCMA and 11.13–18.97 ng/mL for cynomolgus TACI, providing quantitative benchmarks for cell-based functional assays including B cell proliferation, plasma cell differentiation, and NF-κB signaling pathway activation studies. The low-nanogram potency supports dose-response experiments in primary human PBMCs and B cell lines, while cross-reactivity with cynomolgus TACI enables translational studies in non-human primate models of systemic lupus erythematosus or antibody-mediated rejection. Endotoxin levels below 1.0 EU/μg and purity exceeding 90% meet the quality thresholds commonly required for immune cell assays where LPS contamination would confound cytokine-specific responses.
