Abbreviation
Recombinant Human THPO protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 0.4353 - 1.089 ng/mL.
Alternative Names
Thrombopoietin; C-mpl ligand (ML); Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor (MGDF); Myeloproliferative leukemia virus oncogene ligand; THPO; MGDF
Species
Homo sapiens (Human)
Expression Region
22-353aa
Target Protein Sequence
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 0.4353 - 1.089 ng/mL.
Description
Thrombopoietin regulates megakaryocyte maturation and platelet production through c-Mpl receptor activation, making it essential for hematopoietic studies where precise dose-response control is critical. This recombinant protein, spanning the full mature form (aa 22–353) and expressed in mammalian cells to preserve native glycosylation, demonstrates an ED50 of 0.4353–1.089 ng/mL in MO7e cell proliferation assays, providing quantitative benchmarks for titrating biological activity in megakaryocyte differentiation experiments and hematopoietic stem cell expansion protocols. The low ED50 range supports receptor-ligand binding studies, including competition ELISA and surface plasmon resonance assays designed to characterize anti-THPO antibodies or evaluate c-Mpl agonist candidates. With purity exceeding 90% and endotoxin levels below 1.0 EU/μg, this preparation aligns with standards expected in cell-based functional assays and antibody validation workflows where contaminant interference must be minimized.
-SDS.jpg)
-AC1.jpg)
