Abbreviation
Recombinant Human ACVRL1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU), the EC50 is 2.417-2.971 ng/mL.
Alternative Names
ACVRLK1;ALK1;
Species
Homo sapiens (Human)
Expression Region
22-118aa
Target Protein Sequence
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU)，the EC50 is 2.417-2.971 ng/mL.
Description
ACVRL1 (ALK1) functions as a type I receptor for bone morphogenetic protein 9 (BMP9) and BMP10, mediating endothelial cell signaling pathways implicated in vascular remodeling and hereditary hemorrhagic telangiectasia. This recombinant fragment spanning residues 22–118 captures the extracellular ligand-binding domain and demonstrates quantifiable antibody recognition in functional ELISA, with an EC50 of 2.417–2.971 ng/mL when immobilized at 2 μg/mL, confirming conformational integrity suitable for receptor-ligand interaction assays, competitive inhibition screening, and therapeutic antibody epitope mapping. Produced in baculovirus, the protein achieves greater than 95% purity by SDS-PAGE and maintains endotoxin levels below 1.0 EU/μg, meeting the quality thresholds commonly required for surface plasmon resonance (SPR) affinity characterization, biolayer interferometry (BLI), and blocking antibody validation studies. The C-terminal 6xHis tag facilitates oriented immobilization in binding assays, supporting its use as a positive control in drug discovery campaigns targeting BMP signaling in cancer and vascular biology research.
