Abbreviation
Recombinant Human SECTM1 protein, partial (Active)
Purity
Greater than 85% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.②Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
Alternative Names
(Protein K-12)(K12)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
29-145aa
Target Protein Sequence
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.
-
Activity
Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
Description
SECTM1 functions as a ligand for CD7 and plays a role in T-cell costimulation and immune modulation relevant to tumor immunology. This recombinant human SECTM1 (aa 29–145), produced in mammalian cells with a C-terminal hFc tag, demonstrates strong CD7 binding in functional ELISA with an EC50 of 1.811–3.372 ng/ml, confirming its suitability for cell-based T-cell activation and proliferation assays, signaling pathway studies involving NF-κB or MAPK cascades, and antibody development workflows including use as a coating antigen or ELISA positive control. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts that can confound immune cell readouts, making this protein appropriate for sensitive primary PBMC or T-cell functional assays as well as in vivo tumor biology models. Purity exceeding 85% by SDS-PAGE, combined with this stringent endotoxin control, aligns with standards expected in quantitative cytokine detection assays and receptor-ligand interaction studies.
