Recombinant Human Secreted and transmembrane protein 1 (SECTM1), partial (Active)

In Stock
Code: CSB-MP819898HU
Size:
20ug
20ug100ug1mg
US$98
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc1-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human SECTM1 protein, partial (Active)
Purity
Greater than 85% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.②Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
Target Names
SECTM1
Uniprot NO.
Research Area
Cancer
Alternative Names
(Protein K-12)(K12)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-145aa
Target Protein Sequence
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.6 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.
  • Activity
    Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
Description

SECTM1 functions as a ligand for CD7 and plays a role in T-cell costimulation and immune modulation relevant to tumor immunology. This recombinant human SECTM1 (aa 29–145), produced in mammalian cells with a C-terminal hFc tag, demonstrates strong CD7 binding in functional ELISA with an EC50 of 1.811–3.372 ng/ml, confirming its suitability for cell-based T-cell activation and proliferation assays, signaling pathway studies involving NF-κB or MAPK cascades, and antibody development workflows including use as a coating antigen or ELISA positive control. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts that can confound immune cell readouts, making this protein appropriate for sensitive primary PBMC or T-cell functional assays as well as in vivo tumor biology models. Purity exceeding 85% by SDS-PAGE, combined with this stringent endotoxin control, aligns with standards expected in quantitative cytokine detection assays and receptor-ligand interaction studies.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May be involved in thymocyte signaling.
Gene References into Functions
  1. CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues PMID:24157461
  2. SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells. PMID:24211252
  3. level of SECTM1 expression is likely to be a key factor in innate immune responses and in the immune tolerance of cancerous cells PMID:21749909

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted.
Protein Families
SECTM family
Tissue Specificity
Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic
Database Links

HGNC: 10707

UNIGENE: Hs.558009

KEGG: hsa:6398

STRING: 9606.ENSP00000269389

OMIM: 602602

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products