Abbreviation
Recombinant Human CD274 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody(CSB-MA878942A1m,antigen from E.coli), the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.
Alternative Names
B7 H; B7 H1; B7 homolog 1; B7-H1; B7H; B7H1; CD 274; CD274; CD274 antigen; CD274 molecule; MGC142294; MGC142296; OTTHUMP00000021029 ; PD L1; PD-L1; PD1L1_HUMAN; PDCD1 ligand 1; PDCD1L1; PDCD1LG1; PDL 1; PDL1; Programmed cell death 1 ligand 1; Programmed death ligand 1; RGD1566211
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
19-238aa
Target Protein Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time maybe differs from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
PD-L1 is a critical immune checkpoint ligand whose therapeutic targeting demands conformationally accurate recombinant protein for reliable antibody screening and inhibitor discovery. This human CD274 construct spans the extracellular IgV and IgC domains (aa 19–238) and carries a C-terminal hFc1 tag, enabling oriented immobilization in binding assays while mammalian cell expression preserves native glycosylation and disulfide-dependent folding. Functional ELISA confirms robust activity, with an EC50 of 1.252–1.653 ng/mL against an anti-PD-L1 monoclonal antibody, supporting use in competitive blocking antibody screening, epitope mapping, affinity characterization by SPR or BLI, and small-molecule checkpoint inhibitor discovery. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based immune checkpoint co-culture assays and sensitive receptor-ligand interaction studies.