Recombinant Human Poliovirus receptor (PVR) (I340M), partial (Active)

In Stock
Code: CSB-MP019093HU(M)
Size:
20ug
20ug100ug1mg
US$110
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc1-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human PVR protein (I340M), partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
FACS assay shows that Human PVR can bind to HEK293F cell overexpressing human TIGIT.
Target Names
PVR
Uniprot NO.
Alternative Names
PVR; PVS; Poliovirus receptor; Nectin-like protein 5; NECL-5; CD antigen CD155
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-343aa(I340M)
Target Protein Sequence
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64.0 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    FACS assay shows that Human PVR can bind to HEK293F cell overexpressing human TIGIT.
Description

PVR (CD155/NECL-5) serves as a key ligand in the TIGIT immune checkpoint axis, making it a critical tool for dissecting co-inhibitory signaling in tumor immunology and viral entry studies. This recombinant human PVR construct, spanning residues 21–343 with an I340M substitution and a C-terminal hFc1 tag, has been validated by FACS to confirm direct binding to human TIGIT overexpressed on HEK293F cells, supporting use in receptor-ligand binding assays, TIGIT blockade screening, and functional cell-based checkpoint studies. Mammalian cell expression preserves native glycosylation patterns essential for proper folding of PVR's immunoglobulin-like domains, and the hFc1 tag facilitates detection in flow cytometry panels as well as surface plasmon resonance experiments. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and in vivo immune checkpoint modeling.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytotoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration.; (Microbial infection) Acts as a receptor for poliovirus. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.; (Microbial infection) Acts as a receptor for Pseudorabies virus.; (Microbial infection) Is prevented to reach cell surface upon infection by Human cytomegalovirus /HHV-5, presumably to escape immune recognition of infected cell by NK cells.
Gene References into Functions
  1. These findings highlight the importance of the TIGIT/CD226/PVR axis as an immune checkpoint barrier that could hinder future "cure" strategies requiring potent HIV-specific CD8(+) T cells PMID:28084312
  2. Study investigated the more detailed mechanism for this cis-interaction of Necl-5 with the PDGF receptor beta. Necl-5 contains three Ig-like domains and the PDGF receptor beta contains five Ig-like domains at their extracellular regions; showed that the third Ig-like domain of Necl-5 cis-interacted with the fifth Ig-like domain of the PDGF receptor beta. PMID:29431243
  3. Studied association of poliovirus receptor (PVR/CD155) mutation and cleft lip and cleft palate. Validated previous findings that PVR/CD155 markers are associated with cleft lip and palate. PMID:29381645
  4. The authors demonstrate that HIV and specifically Nef and/or Vpu do not modulate CD155 on infected primary T cells and both CD155 and NKG2D ligands synergize as a natural killer cell receptor to trigger natural killer cell lysis of the infected cell. PMID:27296670
  5. Data show that gastric cancer cells inhibit T-cell metabolism through CD155/TIGIT signaling. PMID:28883004
  6. Studies showed that CD155 was frequently overexpressed in human malignant tumors. Its overexpression promotes tumor cell invasion and migration, and is associated with tumor progression. [review] PMID:28730595
  7. soluble CD226 elevated in sera of CTCL patients would be important for tumor immunity by interacting with CD155 on tumor cells. PMID:28395975
  8. data reveal that MICA and PVR are directly regulated by human cytomegalovirus immediate early proteins, and this may be crucial for the onset of an early host antiviral response PMID:27733551
  9. The SNP detection assay was successfully developed for identification of Ala67Thr polymorphism in human PVR/CD155 gene. The SNP assay will be useful for large scale screening of DNA samples. PMID:27834324
  10. sCD155 levels were significantly decreased after surgical resection of cancers. Thus, sCD155 level in serum may be potentially useful as a biomarker for cancer development and progression PMID:27049654
  11. implying that TIGIT exerts immunosuppressive effects by competing with DNAM-1 for the same ligand, CD155 PMID:26842126
  12. The present study provides evidence that regulation of the PVR/CD155 DNAM-1 ligand expression by nitric oxide may represent an additional immune-mediated mechanism and supports the anti-myeloma activity of nitric oxide donors. PMID:25609078
  13. Our findings suggest that loss of CD155 expression may play an important role in the immune escape of HCC cells and thus CD155 may serve as a prognostic marker as well as a potential therapeutic target for HCC. PMID:25320021
  14. CD155 may play a critical role through both immunological and non-immuno logical mechanisms in pancreatic cancer and may be a therapeutic target for this intractable malignancy. PMID:25862891
  15. CD155 (PVR/Necl5) mediates a costimulatory signal in CD4+ T cells and regulates allergic inflammation. PMID:25972481
  16. The cell-surface receptor (Pvr) catalyzes a large structural change in the poliovirus that exposes membrane-binding protein chains. PMID:25631086
  17. In granulosa cells, there are significant changes in expression during follicular maturation. PMID:24828608
  18. UPR decreases CD226 ligand CD155 expression and sensitivity to NK cell-mediated cytotoxicity in hepatoma cells. PMID:25209846
  19. Ala residues 10, 14 and 18 in the TM domain of Vpu are required for CD155 downregulation. PMID:25113908
  20. TIGIT/PVR ligation signaling mediates suppression of IFN-gamma production via the NF-kappaB pathway. PMID:24817116
  21. UL141 can inhibit cell-surface expression of both natural killer (NK) cell-activating ligand CD155 as well as TRAIL death receptors (TRAIL-R1 and TRAIL-R2). PMID:24598754
  22. Vpr upregulates PVR during Hiv-1 infection by activating ATR kinase that triggers the DNA damage rsponse pathway and G2 arrest. PMID:24045107
  23. The CD226/CD155 interaction regulates the proinflammatory (Th1/Th17)/anti-inflammatory (Th2) balance in humans. PMID:23980210
  24. PVR resides in the recently identified lateral border recycling compartment, similar to PECAM and CD99. PMID:23333754
  25. findings suggest Necl-5 expression in lung cancer cells is crucial for their invasiveness in the cancer-stromal interaction PMID:23276719
  26. The concordant computational and experimental data of the present study indicate that the extent of NECL-5 expression correlates with melanoma progression. PMID:22929570
  27. we demonstrated the expression of both CD155 mRNA and protein in bone and soft tissue sarcoma cell lines PMID:22692919
  28. Expression of PVR in B-ALL cells is modulated by epigenetic mechanisms. PMID:22169283
  29. This investigation has enhanced understanding of cell invasion and confirmed CD44 to play a more significant role in this biological process than CD155. PMID:22363471
  30. the PVR downmodulation by Nef and Vpu is a strategy evolved by HIV-1 to prevent NK cell-mediated lysis of infected cells. PMID:22301152
  31. Data show that a high expression of CD112 and CD155 (DNAM-1 ligands) on leukemic blasts. PMID:21383766
  32. The host TICAM-1 pathway, particularly in macrophages, serves as a source of type I interferon induction that protects poliovirus (PV) receptor-bearing transgenic mice from PV infection and paralytic death. PMID:21998457
  33. CD155 is an IFNgamma-inducible immune regulatory protein on the surface of human endothelial cells that attenuates the acquisition of effector functions in CD8 T cells. PMID:21330602
  34. Necl-5 plays a role in mediating tumor cell invasion and that the overexpression of Necl-5 in cancer cells has clinical significance for prognostic evaluation of patients with primary pulmonary adenocarcinoma. PMID:20331633
  35. We propose that the cytoplasmic domain may target CD155-containing endocytic vesicles to the microtubular network PMID:11751937
  36. activation of expression of sonic hedgehog protein PMID:11983699
  37. Data show that both PVR and Nectin-2 represent specific ligands for the DNAM-1 triggering receptor. PMID:12913096
  38. CD155 may have an important role in cellular function PMID:12943679
  39. These data indicate that Tage4 represents the functional orthologue of CD155 in mouse. PMID:14652024
  40. that DNAM-1 regulates monocyte extravasation via its interaction with CD226 expressed at endothelial junctions on normal cells. PMID:15136589
  41. These results suggest that CD155alpha plays a role in the regulation of cell adhesion and cell motility. PMID:15194502
  42. cytoplasmic domain of PVR directly interacts with Tctex-1 and plays an important role in retrograde transport of poliovirus-containing vesicles along microtubules in vivo PMID:15194795
  43. Upregulation of the molecular target CD155 renders explant cultures of high-grade malignant gliomas highly susceptible to a prototype oncolytic poliovirus recombinant. PMID:15279713
  44. Analysis of the ligands for triggering NK receptors revealed the consistent expression of cd155 and cd112 in myeloid leukemias, and less frequent expression in lymphoblastic leukemias PMID:15536144
  45. Evasion of NK cell killing was mediated by human cytomegalovirus UL141 blocking surface expression of CD155 PMID:15640804
  46. Necl-5 has a critical role in integrin alphavbeta3 clustering and focal complex formation PMID:17446174
  47. Results describe the establishment of a poliovirus oral infection system in human poliovirus receptor-expressing transgenic mice that are deficient in alpha/beta interferon receptor. PMID:17507470
  48. no statistically significant association between this marker allele and non-syndromic clefting PMID:17534374
  49. CD155, at least in part, enhances the proliferation of ras-mutated cells PMID:17893876
  50. crystal structure of C155 D1D2 has been determined to 3.5-A resolution and fitted into approximately 8.5-A resolution cryoelectron microscopy reconstructions of the virus-receptor complexes for the 3 PV serotypes PMID:19011098

Show More

Hide All

Subcellular Location
[Isoform Alpha]: Cell membrane; Single-pass type I membrane protein.; [Isoform Delta]: Cell membrane; Single-pass type I membrane protein.; [Isoform Beta]: Secreted.; [Isoform Gamma]: Secreted.
Protein Families
Nectin family
Database Links

HGNC: 9705

UNIGENE: Hs.171844

KEGG: hsa:5817

STRING: 9606.ENSP00000402060

OMIM: 173850

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products