Abbreviation
Recombinant Human SELP protein (V640L), partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human SELP at 2 μg/mL can bind Anti-SELP recombinant antibody (CSB-RA020978MA2HU). The EC50 is 3.120-3.578 ng/mL. ②SELP Recombinant Monoclonal Antibody (CSB-RA020978MA2HU) captured on Protein A Chip can bind Recombinant Human SELP with an affinity constant of 0.956 nM as detected by MetaSPR Assay (WeSPRTM 200).
Alternative Names
P-selectin; CD62 antigen-like family member P; Granule membrane protein 140; GMP-140; Leukocyte-endothelial cell adhesion molecule 3; LECAM3; Platelet activation dependent granule-external membrane protein; PADGEM; CD antigen CD62P
Species
Homo sapiens (Human)
Expression Region
42-771aa(V640L)
Target Protein Sequence
WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human SELP at 2 μg/ml can bind Anti-SELP recombinant antibody (CSB-RA020978MA2HU). The EC50 is 3.120-3.578 ng/mL.
-
Activity
SELP Recombinant Monoclonal Antibody (CSB-RA020978MA2HU) captured on Protein A Chip can bind Recombinant Human SELP with an affinity constant of 0.956 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
P-selectin mediates the initial tethering and rolling of leukocytes on activated endothelium and platelets, a critical step in inflammation and metastasis that has made it a therapeutic target in cancer and cardiovascular disease. This mammalian-expressed construct spanning residues 42–771 with the V640L variant retains native glycosylation and demonstrates quantified binding to a recombinant anti-SELP antibody with an EC50 of 3.120–3.578 ng/mL in functional ELISA and a KD of 0.956 nM by surface plasmon resonance, confirming that the extracellular domain adopts a conformation competent for ligand recognition. These binding parameters support use in selectin-ligand interaction studies, antibody development and epitope mapping, and cell adhesion assays investigating leukocyte rolling or tumor cell arrest on endothelial monolayers. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg meet the quality thresholds commonly required for functional cell-based assays and in vitro binding experiments.