Abbreviation
Recombinant Human MUC16 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/ml can bind MSLN(CSB-MP015044HUc9), the EC50 is 460.7-662.2 ng/ml.
Alternative Names
(MUC-16)(Ovarian cancer-related tumor marker CA125)(CA-125)(CA125)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
12660-12923aa
Target Protein Sequence
GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/ml can bind MSLN(CSB-MP015044HUc9), the EC50 is 460.7-662.2 ng/ml.
Description
Mucin-16 (MUC16), the high-molecular-weight glycoprotein widely recognized as the CA-125 antigen, plays a central role in ovarian and other epithelial cancer biology through its interaction with mesothelin (MSLN). This recombinant partial construct, spanning residues 12660–12923 of the human sequence, has been validated in functional ELISA demonstrating direct binding to MSLN with an EC50 of 460.7–662.2 ng/ml, providing a reliable tool for MUC16–MSLN interaction studies, receptor-ligand blocking assays, and antibody screening campaigns targeting this clinically relevant epitope. Produced in mammalian cells with a C-terminal 6×His tag, the protein retains post-translational modifications critical for physiologically meaningful binding data. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for both cell-based functional assays investigating MUC16-mediated signaling and immunization protocols aimed at generating research-grade or therapeutic antibody candidates.