Abbreviation
Recombinant Human MICA protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse NKG2D (N-6His) at 2 μg/ml can bind Human MICA (C-Fc), the EC50 of Human MICA (C-Fc) is not higher than 10 ng/ml.
Research Area
Signal Transduction
Alternative Names
MHC class I chain-related protein A; MHC class I chain-related protein B; MHC class I polypeptide related sequence A; MHC class I polypeptide related sequence B; MHC class I polypeptide-related sequence A; MIC-A; micA; MICA_HUMAN; MICB
Species
Homo sapiens (Human)
Expression Region
24-308aa
Target Protein Sequence
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time maybe differs from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
MICA is a stress-induced ligand for the activating receptor NKG2D, making it a critical mediator of NK cell and cytotoxic T cell surveillance against tumors and infected cells. This recombinant human MICA construct (aa 24–308) carries a C-terminal Fc tag and demonstrates strong binding to mouse NKG2D in functional ELISA with an EC50 no higher than 10 ng/ml, providing a reliable positive control for NKG2D–ligand interaction studies and receptor-blocking assays. Mammalian cell expression preserves native glycosylation patterns essential for proper MICA folding and receptor engagement, supporting use in cell-based NK activation assays, antibody development campaigns targeting the MICA ectodomain, and surface plasmon resonance binding kinetics experiments. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for functional cell-based assays where endotoxin-driven background activation could otherwise confound NKG2D-dependent readouts.
