Abbreviation
Recombinant Human LAG3 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human LAG3 at 2 μg/mL can bind Anti-LAG3 recombinant antibody(CSB-RA012719MA1HU). The EC50 is 2.306-2.731 ng/mL.
Alternative Names
Lymphocyte activation gene 3 protein; LAG-3; CD223; LAG3; FDC
Species
Homo sapiens (Human)
Expression Region
23-434aa
Target Protein Sequence
LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial of Isoform 1
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human LAG3 at 2 μg/ml can bind Anti-LAG3 recombinant antibody(CSB-RA012719MA1HU). The EC50 is 2.306-2.731 ng/mL.
Description
LAG-3 functions as an immune checkpoint receptor that negatively regulates T-cell activation and proliferation, making it a critical target for immuno-oncology research and therapeutic antibody development. This recombinant protein spans the extracellular domain (aa 23–434) and demonstrates quantifiable binding activity with an EC50 of 2.306–2.731 ng/mL against an anti-LAG-3 antibody in functional ELISA, confirming that the mammalian expression system has preserved the native conformational epitopes required for antibody recognition. The validated binding kinetics support its use in competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening campaigns where accurate representation of native receptor structure is essential. With endotoxin levels below 1.0 EU/μg and purity exceeding 90%, this protein aligns with standards expected in surface plasmon resonance and biolayer interferometry experiments for affinity characterization of LAG-3-targeting biologics.
