Abbreviation
Recombinant Human IL4R protein, partial, Biotinylated (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL4(CSB-MP011659HU) at 2 μg/mL can bind biotinylated Human IL4R. The EC50 is 12.68-14.23 ng/mL.
Alternative Names
IL4RA;582J2.1
Species
Homo sapiens (Human)
Expression Region
26-232aa
Target Protein Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL4(CSB-MP011659HU) at 2μg/mL can bind biotinylated Human IL4R，the EC50 is 12.68-14.23 ng/mL.
Description
IL4R mediates the pleiotropic effects of interleukin-4 in immune regulation and allergic inflammation, making its extracellular domain a critical target for therapeutic antibody development and mechanistic studies of cytokine signaling. This mammalian-expressed fragment spanning residues 26–232 captures the ligand-binding domain with native glycosylation patterns that support physiologically relevant interactions, as demonstrated by functional ELISA showing an EC50 of 12.68–14.23 ng/mL when binding immobilized IL-4. The quantified binding affinity provides a validated basis for competitive inhibition assays, blocking antibody screening, and therapeutic antibody epitope mapping studies where accurate receptor-ligand kinetics are essential. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this biotinylated receptor meets the quality thresholds commonly required for surface plasmon resonance, biolayer interferometry, and sandwich ELISA formats in drug discovery workflows targeting IL-4/IL-13 signaling pathways.
