Abbreviation
Recombinant Human IL4R protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
①The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-20 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized Human IL-4 RA-Fc at 5μg/ml can bind Human IL-4 (Biotinylated by NHS-biotin prior to testing), the ED50 of Human IL-4 is 2.43 ng/ml.
Alternative Names
IL4R; IL4RA; 582J2.1; Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD antigen CD124
Species
Homo sapiens (Human)
Expression Region
26-231aa
Target Protein Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Extracellular Domain
Tag Info
C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
IL-4Rα is a critical signaling hub in type I and type II IL-4/IL-13 receptor complexes, making its extracellular domain (aa 26–231) an essential tool for dissecting Th2-driven immune pathways. This C-terminal Fc-tagged construct, expressed in mammalian cells to preserve native glycosylation and conformational integrity, demonstrates robust ligand engagement: immobilized IL-4Rα-Fc binds biotinylated human IL-4 with an ED50 of 2.43 ng/mL in functional ELISA, and it inhibits IL-4-dependent proliferation of TF-1 cells with an ED50 of 5–20 ng/mL, confirming biologically relevant blocking activity. These validated activities provide a suitable basis for receptor-ligand interaction assays by ELISA, SPR, or BLI, competitive inhibition studies, blocking antibody screening, and therapeutic antibody epitope mapping. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based neutralization assays and sensitive drug discovery screening campaigns.
