Abbreviation
Recombinant Human IL-13 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using TF-1 cells. The ED50 ≤1.0ng/ml,corresponding to a specific activity of ≥1×10^6 U/mg.
Alternative Names
Interleukin-13; IL-13
Species
Homo sapiens (Human)
Expression Region
35-146aa
Target Protein Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
IL-13 drives Th2-polarized immune responses and is a central mediator in allergic inflammation, asthma pathogenesis, and fibrotic disease models, making functional validation of recombinant preparations essential for mechanistic studies. This tag-free protein, spanning residues 35–146 of the mature human sequence, demonstrates robust signaling potency in TF-1 cell proliferation assays with an ED50 ≤1.0 ng/ml, corresponding to a specific activity of ≥1×10⁶ U/mg—a threshold that supports use in dose-response experiments examining JAK1/STAT6 pathway activation, primary T-cell differentiation toward Th2 phenotypes, and B-cell IgE class switching. Endotoxin levels ≤10 EU/mg minimize LPS-driven artifacts in assays using monocytes, macrophages, or other innate immune cells, where contaminating endotoxin can confound cytokine-specific readouts. Purity exceeding 95% by SDS-PAGE, combined with the validated proliferative activity, provides a suitable basis for antibody development workflows, including immunogen preparation and ELISA standard curve generation.