Abbreviation
Recombinant Human IFNA1 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human IFNA1 at 2 μg/mL can bind Anti-IFNA1 recombinant antibody(CSB-RA365592MA1HU). The EC50 is 12.11-13.37 ng/mL.
Alternative Names
Interferon alpha-1/13; IFN-alpha-1/13; Interferon alpha-D (LeIF D); IFNA1; IFNA13
Species
Homo sapiens (Human)
Expression Region
24-189aa
Target Protein Sequence
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human IFNA1 at 2 μg/ml can bind Anti-IFNA1 recombinant antibody(CSB-RA365592MA1HU). The EC50 is 12.11-13.37 ng/mL.
Description
Type I interferons drive antiviral and antiproliferative responses through JAK/STAT signaling, yet recombinant preparations often suffer from endotoxin contamination that confounds immune cell readouts. This full-length mature protein (aa 24–189) demonstrates specific receptor engagement with an EC50 of 12.11–13.37 ng/mL in a functional ELISA against an anti-IFNA1 antibody, providing quantitative evidence of proper folding and epitope accessibility suitable for antibody development, ELISA standardization, and Western blot controls. Endotoxin levels below 1.0 EU/μg meet the contamination thresholds commonly required for cell-based assays with primary PBMCs, T cells, or B cells, where even trace LPS can trigger spurious activation and obscure interferon-specific effects on proliferation, differentiation, or apoptosis. Purity exceeding 95% by SDS-PAGE supports use in JAK/STAT and NF-κB pathway studies where contaminating proteins would introduce competing signals.