Home
Product
Protein
Active Protein
Other
Recombinant Human Insulin growth factor-like family member 1 (IGFL1) (Active)

Recombinant Human Insulin growth factor-like family member 1 (IGFL1) (Active)

CSB-MP764932HU

Rate （4.0）
Review （1）

Size:

20ug100ug1mg

US$138

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal hFc1-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 μg/mL can bind Human IGFL1, the EC₅₀ is 32.33-47.52 ng/mL.

Target Names

IGFL1

Uniprot NO.

Q6UW32

Research Area

other

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

25-110aa

Target Protein Sequence

APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Mol. Weight

38.7 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal hFc1-tagged

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Storage

Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 μg/ml can bind Human IGFL1, the EC₅₀ is 32.33-47.52 ng/mL.

Description

Recombinant human IGFL1 protein is produced by a mammalian expression system. The target protein is expressed with a DNA fragment (Ala25-Ser110) of human IGFL1 fused with a hFc tag at the C-terminus. This active IGFL1 protein has been measured its activity in a functional ELISA. Immobilized human IGFLR1 binds to this IGFL1 protein with EC₅₀ of 32.33-47.52 ng/mL. The SDS-PAGE showed that the purity of this IGFL1 protein was greater than 95%. The IGFL1 protein has an apparent molecular weight of approximately 40 kDa due to glycosylation. The LAL method showed that the protein contained endotoxin less than 1.0 EU/ug. This human IGFL1 protein is in stock now.

IGFL1 is expressed in cancer cell lines, fetal skin, head and neck tumors, normal breast, squamous cell carcinoma, and uterine tumors. IGFL1 expression is up-regulated in human psoriasis skin. Studies showed that human IGFL1 produced may regulate T cell response. Xiaorong Ji et al. found that high IGFL1 expression can be used as an independent prognostic factor of serous ovarian carcinoma.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

4.0 - 1 reviews

Submit a Review here

Applications : a:1:{i:0;a:2:{i:0;s:41:"Binding assay/Protein-protein interaction";i:1;s:0:"";}}

Review: describe

By Anonymous

Target Background

Function

Probable ligand of the IGFLR1 cell membrane receptor.

Gene References into Functions

Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1. PMID:21454693
The -1245 A-allele of the IGF1 promoter single nucleotide polymorphism is associated with a small head size and less brain sparing in small for gestational age born subjects PMID:19147602

Hide All

Subcellular Location

Secreted.

Protein Families

IGFL family

Tissue Specificity

Detected in ovary and spinal cord.

Database Links

HGNC: 24093

UNIGENE: Hs.546554

KEGG: hsa:374918

OMIM: 610544