Abbreviation
Recombinant Human G-CSF protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
The activity is determined by the dose-dependent proliferation of murine NFS-60 cells is < 0.5 ng/ml, corresponding to a specific activity of ≥ 1 x 10^7 units/mg.
Alternative Names
Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF
Species
Homo sapiens (Human)
Expression Region
31-204aa
Target Protein Sequence
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS,5% mannitoland 0.01% Tween 80, pH7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
Granulocyte colony-stimulating factor drives neutrophil lineage commitment and mobilization, making it a critical tool for dissecting myeloid differentiation and emergency granulopoiesis. This tag-free protein, spanning residues 31–204 of the mature human sequence, demonstrates potent bioactivity with an ED50 below 0.5 ng/ml in NFS-60 cell proliferation assays, corresponding to a specific activity exceeding 1 × 10⁷ units/mg—a threshold that supports dose-response studies in primary hematopoietic progenitor cultures and JAK/STAT signaling pathway investigations. Endotoxin levels remain at or below 10 EU/mg, meeting the contamination criteria typical for immune cell functional assays where LPS artifacts would confound cytokine-specific responses. The combination of greater than 95% purity and validated proliferative activity provides a suitable basis for antibody development workflows, including use as an immunogen or ELISA standard in cytokine detection platforms.