Abbreviation
Recombinant Human FGFR3 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human FGFR3 at 2 μg/mL can bind Anti-FGFR3 recombinant antibody (CSB-RA008646MA1HU). The EC50 is 0.6767-0.8946 ng/mL.
Alternative Names
Fibroblast growth factor receptor 3; EC:2.7.10.1; FGFR-3; CD333; FGFR3; JTK4
Species
Homo sapiens (Human)
Expression Region
23-375aa
Target Protein Sequence
ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human FGFR3 at 2 μg/ml can bind Anti-FGFR3 recombinant antibody (CSB-RA008646MA1HU). The EC50 is 0.6767-0.8946 ng/mL.
-
The purity of FGFR3 was greater than 95% as determined by SEC-HPLC
Description
FGFR3 mutations drive constitutive kinase activation in multiple myeloma and bladder cancer, making the extracellular domain a critical target for therapeutic antibody development and small-molecule inhibitor screening. This mammalian-expressed construct spanning residues 23–375 captures the complete ligand-binding region and demonstrates quantifiable antibody recognition in functional ELISA, with an EC50 of 0.68–0.89 ng/mL when binding a recombinant anti-FGFR3 antibody—a result that supports its use in competitive inhibition assays, blocking antibody screening, and epitope mapping studies for biologics targeting oncogenic FGFR3 variants. The mammalian expression system preserves native glycosylation patterns essential for conformational integrity in surface plasmon resonance and biolayer interferometry experiments characterizing receptor-ligand or receptor-antibody interactions. Purity exceeding 90% and endotoxin below 1.0 EU/μg align with standards expected in therapeutic antibody validation workflows and high-throughput drug discovery campaigns.