Abbreviation
Recombinant Human FGF2 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤0.1EU/μg by the LAL method
Activity
Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast Cells. The ED50 for this effect ≤2.0 ng/mL.
Alternative Names
Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
Species
Homo sapiens (Human)
Expression Region
143-288aa
Target Protein Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
FGF2 orchestrates cell proliferation, survival, and differentiation across multiple lineages, making it a critical tool for stem cell maintenance, neuronal differentiation protocols, and angiogenesis models. This tag-free preparation spans residues 143–288, representing the full-length mature protein, and demonstrates robust mitogenic activity with an ED50 ≤2.0 ng/mL in NIH3T3 fibroblast proliferation assays—a potency level that supports dose-response studies in stem cell expansion, osteogenic differentiation experiments, and wound healing models where precise receptor engagement is essential. Endotoxin content ≤0.1 EU/μg aligns with standards expected in primary cell culture and in vivo regenerative medicine studies, while >95% purity by SDS-PAGE provides a suitable basis for receptor-ligand binding assays, antibody characterization, and ELISA standard curve generation. Expression in E. coli yields unglycosylated protein, appropriate for applications where post-translational modifications are not required for biological activity.
