Abbreviation
Recombinant Human DKK1 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 μg/mL can bind Anti-DKK1 recombinant antibody (CSB-RA006920MA1HU), the EC50 is 1.283-2.544 ng/mL.
Research Area
Cardiovascular
Alternative Names
(Dickkopf-1)(Dkk-1)( hDkk-1)(SK)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
32-266aa
Target Protein Sequence
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 μg/mL can bind Anti-DKK1 recombinant antibody (CSB-RA006920MA1HU), the EC50 is 1.283-2.544 ng/mL.
Description
DKK1 is a potent secreted antagonist of the canonical Wnt/β-catenin signaling pathway, making it a critical tool for dissecting Wnt-dependent processes in bone metabolism, cardiovascular remodeling, and stem cell differentiation. This recombinant human DKK1, covering the full-length mature protein (aa 32–266) with a C-terminal 10×His tag, demonstrates robust binding activity validated by functional ELISA, where immobilized DKK1 at 2 μg/mL bound anti-DKK1 recombinant antibody with an EC50 of 1.283–2.544 ng/mL — confirming proper folding and epitope accessibility that supports use in antibody screening, receptor-ligand interaction studies, and Wnt pathway inhibition assays. Mammalian cell expression ensures native-like glycosylation and disulfide bond formation essential for DKK1's two cysteine-rich domains to adopt functional conformations. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based Wnt reporter assays and in vivo cardiovascular disease models.
-SDS.jpg)
-AC1.jpg)
.svg)
