Abbreviation
Recombinant Human CLDN4 protein-VLPs (Active)
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody (CSB-RA005506MA1HU), the EC50 is 29.56-50.75 ng/mL.
Alternative Names
(Clostridium perfringens enterotoxin receptor)(CPE-R)(CPE-receptor)(Williams-Beuren syndrome chromosomal region 8 protein)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
1-209aa
Target Protein Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
CSB-MP005506HU is detected by Mouse anti-6*His monoclonal antibody.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/ml can bind Anti-CLDN4 recombinant antibody (CSB-RA005506MA1HU), the EC50 is 29.56-50.75 ng/mL.
Description
Claudin-4 is a tight junction transmembrane protein frequently overexpressed in ovarian, pancreatic, and breast cancers, making it a high-priority target for antibody screening and therapeutic development. This recombinant human CLDN4 is presented on virus-like particles (VLPs), preserving the native multi-pass transmembrane topology that is lost when the protein is solubilized in conventional formats — a critical advantage for generating conformationally relevant immune responses and accurate binding data. Functional ELISA confirms robust receptor activity: immobilized at 5 μg/mL, the protein binds an anti-CLDN4 recombinant antibody with an EC50 of 29.56–50.75 ng/mL, supporting use in antibody characterization, phage display panning, and immunization campaigns targeting membrane-intact epitopes. Expressed in mammalian cells as the full-length sequence (aa 1–209) with a C-terminal 10×His tag, this preparation carries endotoxin levels below 1.0 EU/μg, satisfying the purity and endotoxin criteria typical for functional cell-based binding assays and in vivo immunization studies.