Abbreviation
Recombinant Human CTSD protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2.The specific activity is >2000 pmol/min/µg.
Alternative Names
Cathepsin D; EC 3.4.23.5 [Cleaved into: Cathepsin D light chain; Cathepsin D heavy chain]
Species
Homo sapiens (Human)
Expression Region
21-412aa
Target Protein Sequence
LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2.The specific activity is >2000 pmol/min/µg.
Description
Cathepsin D is an aspartic endopeptidase critical for lysosomal protein degradation and implicated in neurodegenerative disease pathways, making its catalytic function a key target for mechanistic and therapeutic studies. This full-length active enzyme (aa 21–412) demonstrates a specific activity exceeding 2000 pmol/min/µg against the fluorogenic substrate Mca-PLGL-Dpa-AR-NH2, providing a quantitative benchmark that supports kinetic parameter analysis including Km and kcat/Km determination, inhibitor screening with IC50 measurements, and substrate specificity profiling. The C-terminal His tag preserves access to the active site cleft while facilitating purification to greater than 95% by SDS-PAGE, a threshold that meets the quality criteria commonly required for accurate enzymatic assays and serves as a reliable positive control in enzyme-linked detection systems. Endotoxin levels below 1.0 EU/µg align with standards expected in cell-based inhibitor evaluation and drug candidate testing where low contaminant interference is essential.