Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) (Active)

In Stock
Code: CSB-MP005166HU
Size:
20ug
20ug100ug1mg
US$102
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CEACAM6 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8 (CSB-MP005168HU), the EC50 is 144.7-223.8 ng/mL.②Measured by its binding ability in a functional ELISA.Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody (CSB-RA005165MA2HU), the EC50 is 0.9430-1.377 ng/mL.
Target Names
CEACAM6
Uniprot NO.
Research Area
Tags & Cell Markers
Alternative Names
(Non-specific crossreacting antigen)(Normal cross-reacting antigen)(CD66c)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
35-320aa
Target Protein Sequence
KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8 (CSB-MP005168HU), the EC50 is 144.7-223.8 ng/mL.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody (CSB-RA005165MA2HU), the EC50 is 0.9430-1.377 ng/mL.
Description

CEACAM6 mediates homotypic and heterotypic cell adhesion events implicated in tumor metastasis, immune cell trafficking, and neutrophil activation, making functionally validated protein essential for dissecting these interactions. This recombinant human CEACAM6 covers the full-length mature protein (aa 35–320) with a C-terminal 10×His tag, and mammalian expression ensures native glycosylation and proper folding of its immunoglobulin-like domains. Functional ELISA confirms binding to human CEACAM8 (EC50 144.7–223.8 ng/mL) and to an anti-CEACAM5/CEACAM6 recombinant antibody (EC50 0.9430–1.377 ng/mL), providing a suitable basis for cell adhesion and spreading assays, cell migration and invasion studies, and antibody development or validation campaigns. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for integrin-ligand binding studies and cell-based metastasis models where contaminant interference must be minimized.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cell surface glycoprotein that plays a role in cell adhesion and tumor progression. Intercellular adhesion occurs in a calcium- and fibronectin-independent manner. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM5 and CEACAM8. Heterophilic interaction with CEACAM8 occurs in activated neutrophils. Plays a role in neutrophil adhesion to cytokine-activated endothelial cells. Plays a role as an oncogene by promoting tumor progression; positively regulates cell migration, cell adhesion to endothelial cells and cell invasion. Also involved in the metastatic cascade process by inducing gain resistance to anoikis of pancreatic adenocarcinoma and colorectal carcinoma cells.
Gene References into Functions
  1. CEACAM6 promoted oral squamous cell carcinoma cell invasion, migration, cytoskeletal rearrangement, and metastasis via interaction with EGFR and enhancing it activation. PMID:28892050
  2. Studies provide evidence that dysregulated overexpression of CEACAM6 plays a role in several of the hallmarks of cancer, including uncontrolled proliferation, anoikis resistance, immune evasion, invasion and metastasis. [review] PMID:29110374
  3. Helicobacter pylori HopQ binds the amino-terminal IgV-like domain of human CEACAM1, CEACAM3, CEACAM5 or CEACAM6 proteins, thereby enabling translocation of the major pathogenicity factor CagA into host cells. PMID:27748756
  4. Here, the authors identify members of the carcinoembryonic antigen-related cell adhesion molecule (CEACAM) family as receptors of Helicobacter pylori and show that HopQ is the surface-exposed adhesin that specifically binds human CEACAM1, CEACAM3, CEACAM5 and CEACAM6. PMID:27748768
  5. CD66c (KOR-SA3544) antigen expression of leukemic blasts in pediatric acute myeloid leukemia with TLS/FUS-ERG fusion transcript PMID:28766906
  6. Data suggest that the expression of these TSPAN8, LGALS4, COL1A2 and CEACAM6 in the whole blood may be useful in the detection of colorectal cancer (CRC). PMID:26993598
  7. expression is increased in severe asthma and primarily associated with airway epithelial cells and tissue neutrophils PMID:28275137
  8. a 7-gene signature was identified which correctly predicted the primary prefibrotic myelofibrosis group with a sensitivity of 100% and a specificity of 89%. The 7 genes included MPO, CEACAM8, CRISP3, MS4A3, CEACAM6, HEMGN, and MMP8 PMID:27579896
  9. In enterocytic C2BBe1 cells, Candida albicans caused a transient tyrosine phosphorylation of CEACAM1 and induced higher expression of membrane-bound CEACAM1 and soluble CEACAM6. PMID:28292985
  10. Monoclonal Antibody 1B5A5 Against CEACAM6 PMID:27328063
  11. western blot analysis results indicated that the 1B5A5 epitope is located within an amino-terminal domain of CEACAM6. These results raised the possibility that our approach could lead to discovery of novel biomarkers for the early stage of cancers in a relatively short period of time. PMID:27172290
  12. show the upregulation of the tumor-associated antigens CEACAM5/6 by trans-signaling of the pro-inflammatory cytokine IL-6 PMID:26673628
  13. Biliary CEACAM6 can identify patients with extrahepatic cholangiocarcinoma with a high degree of sensitivity and should be investigated further as a potential screening tool. PMID:26974538
  14. Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another. PMID:26483485
  15. CEACAM6 protein and mRNA were increased ~4-fold in lungs from infants with chronic lung disease as compared with controls. PMID:26374831
  16. vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer PMID:25872647
  17. CEACAM6 increased the levels of phosphorylated AKT, which is involved in the progression of a variety of human tumors. PMID:25398131
  18. Data show that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) and forkhead box P3 (FOXP3) are associated with the malignant degree of pancreatic cancer. PMID:26271985
  19. Data indicate that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) promotes angiogenesis in gastric cancer via focal adhesion kinase FAK signaling. PMID:25703140
  20. Results show that pancreatic cancer patients with CEACAM 1, 5 and 6 expression showed a significantly shortened overall survival and elevated serum values are correlated with distant metastasis suggesting a role in epithelial-mesenchymal transition. PMID:25409014
  21. CEACAM6 may be a valuable biomarker screening for gastric tumor and novel predictor for patients in advanced stages of gastric cancer PMID:25299082
  22. results suggested that CEACAM6 functions as an oncoprotein in gastric cancer and may be an important metastatic biomarker and therapeutic target PMID:24492534
  23. CEACAM6 expression was expressed in different molecular subtypes of breast cancer. Among different subtypes, the highest expression was found with HER2 positive cancers. PMID:24186057
  24. High carcinoembryonic cell adhesion molecule 6 expression is associated with malignant biliary stenoses. PMID:23806607
  25. our findings identified CEACAM6, which is regulated by miR-29a/b/c, as an important positive regulator of EMT in pancreatic cancer PMID:23857344
  26. CD66c expression appears useful only as a predictor of the Ph in adult patients (not in pediatric cases). PMID:24014076
  27. Data indicate that CD66c is frequently expressed in CRLF2-positive as well as hypodiploid cases. PMID:24231528
  28. these findings show that PDEF-CEACAM6 is a highly active oncogenic axis in breast cancer PMID:23592399
  29. CEACAM-6 plays an important role in the regulation of CD8+ T-cell responses against multiple myeloma. PMID:23603913
  30. CEACAM6 is significantly upregulated in colon cancer tissues and is closely associated with poor prognosis. PMID:22975528
  31. The expression of CD66c was significantly higher in colorectal cancer specimens than in normal colon. PMID:23027178
  32. CEACAM6 is focally overexpressed in a large fraction of human HNSCCs in situ. over-expression of CEACAM6 increases tumour growth and tumour initiating activity by suppressing PI3K/AKT-dependent apoptosis of HNSCC in a xenotransplant model of HNSCC. PMID:23021083
  33. High CEACAM6 expresssion is associated with inflammatory bowel disease. PMID:21994005
  34. a novel role for NA in enhancing host cell survival by activating the Src/Akt signaling axis via an interaction with carcinoembryonic antigen-related cell adhesion molecule 6/cluster of differentiation 66c (C6). PMID:22396546
  35. The authors show that the expression of CEACAM1 and CEACAM6 potentiate CEACAM3-dependent responses of neutrophils, exposing a cooperative role for this family of proteins during neisserial infection of neutrophils. PMID:22064717
  36. CEACAM6 is expressed by alveolar and airway epithelial cells of human lung and is secreted into lung-lining fluid, where fully glycosylated protein binds to surfactant. PMID:22037359
  37. Despite its important role in bacterial attachment in ileal CD, no role was detected for CEACAM6 variants in IBD susceptibility or regarding an ileal CD phenotype PMID:21559399
  38. The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation. PMID:21470677
  39. High serum CEACAM6 is associated with gastric cancer. PMID:21618249
  40. CEACAM6 and a regulatory element near the 3' end of CEACAM3 are associated with cystic fibrosis disease severity and intrapair discordance PMID:20047061
  41. Positivity for both leukemia-associated antigens CD66c and CD25 in combination can predict the presence of BCR/ABL rearrangement in pre-B cell acute lymphoblastic leukemia PMID:20063526
  42. Overexpression of CEACAM6 disrupts tissue architecture and blocks colonocyte differentiation PMID:11896570
  43. CEACAM6 subdomains involved in intercellular adhesion activity and subdomains involved in inhibition of cell differentation are identified and their respective activities are independently blocked. PMID:12571231
  44. CEACAM6 gene silencing reversed the acquired anoikis resistance of tumor cell lines and inhibited in vivo metastatic ability PMID:14724575
  45. overexpression among human malignancies, immunological targeting of this tumor antigen may have therapeutic applicability PMID:15081416
  46. the results show that recognition of CEA and CEACAM6, but not CEACAM1, is accompanied by tight attachment to bacteria of cell surface microvilli-like extensions PMID:15130118
  47. CEACAM6 is an important determinant of pancreatic adenocarcinoma malignant cellular behavior PMID:15208677
  48. Levels of CEACAM6 expression can modulate pancreatic adenocarcinoma cellular invasiveness in a c-Src-dependent manner PMID:15316565
  49. CD66c is regulated in a manner distinct from other myeloid antigens in childhood lymphoblastic leukemia PMID:15826304
  50. Data show that variants of Neisseria gonorrhoeae that bind to human carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) 1 and 6 failed to induce detachment and, instead, promoted enhanced host cell adhesion to the ECM. PMID:16115956

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Apical cell membrane. Cell surface.
Protein Families
Immunoglobulin superfamily, CEA family
Tissue Specificity
Expressed in neutrophils. Expressed in columnar epithelial and goblet cells of the colon. Expressed in numerous tumor cell lines (at protein level).
Database Links

HGNC: 1818

UNIGENE: Hs.466814

KEGG: hsa:4680

STRING: 9606.ENSP00000199764

OMIM: 163980

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products