Recombinant Human Carbonic anhydrase 13 (CA13) (Active)

In Stock Discontinued
Code: CSB-AP005401HU
Size:
10ug
10ug50ug500ug1mg(1mg*1 or 500ug*2)
US$116
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The esterase activity is determined to be greater than 1000 pmol/min/ug
Target Names
CA13
Uniprot NO.
Research Area
Cell Biology
Alternative Names
CA 13; CA XIII; CA-XIII; CA13; CA13 carbonic anhydrase XIII ; CAH13_HUMAN; Carbonate dehydratase XIII; Carbonic anhydrase 13; Carbonic anhydrase XIII; CAXIII; EC=4.2.1.1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-262aa
Target Protein Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.51 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Our Recombinant Human CA13 protein is an essential research tool for scientists in the field of cell biology. Carbonic anhydrase 13, also known as CA13, is produced in E. coli, and features the full-length expression region from 1-262aa. The protein is fused with a C-terminal 6xHis-tag for ease of purification and identification. The lyophilized powder format allows for straightforward reconstitution with sterile water or buffer to suit various experimental needs.

The Recombinant Human CA13 protein demonstrates high quality and performance with a purity greater than 95%, as determined by SDS-PAGE analysis. Additionally, endotoxin levels are maintained below 1.0 EU/µg, as assessed by the LAL method. The protein exhibits esterase activity greater than 1000 pmol/min/ug, highlighting its functionality for relevant applications.

Human CA13 has been a subject of interest in numerous research studies due to its role in catalyzing the reversible hydration of carbon dioxide. Research conducted by Frost et al. (2005)[1] and Aspatwar et al. (2010)[2] contributed to a better understanding of the function and potential clinical applications of CA13. These studies highlight the importance of CA13 in maintaining cellular pH homeostasis and its potential therapeutic value.

References:
1. Frost SC, et al. Carbonic anhydrase: mechanism, regulation, links to disease, and industrial applications. Nat Rev Mol Cell Biol. 2005;6(10):713-27.
2. Aspatwar A, et al. Carbonic anhydrase related proteins: Molecular biology and evolution. Subcell Biochem. 2014;75:135-56.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Reversible hydration of carbon dioxide.
Gene References into Functions
  1. a unique and widespread distribution pattern for CA XIII compared with the other cytosolic CA isozymes. May play important physiological roles in several organs PMID:14600151
  2. cytosolic CA I, II, and XIII are downregulated in neoplastic colorectal mucosa compared to normal colorectal mucosa PMID:15836783
  3. Cytosolic carbonic anhydrase XIII may have a role in maintaining the acid-base balance in the kidney and the gastrointestinal and reproductive tracts. [review] PMID:18336313

Show More

Hide All

Protein Families
Alpha-carbonic anhydrase family
Tissue Specificity
Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.
Database Links

HGNC: 14914

UNIGENE: Hs.127189

KEGG: hsa:377677

OMIM: 611436

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products