Recombinant Human CD276 antigen (CD276), partial (Active)

In Stock
Code: CSB-MP733578HU(F2)
Size:
20ug
20ug100ug1mg
US$118
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CD276 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/mL can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC50 is 47.12-54.16 ng/mL.
Target Names
CD276
Uniprot NO.
Alternative Names
4Ig-B7-H3; B7 homolog 3 (B7-H3); Costimulatory molecule; CD276
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-245aa
Target Protein Sequence
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.7 kDa
Protein Length
Partial of Isoform 2
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/ml can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC50 is 47.12-54.16 ng/mL.
  • The purity of CD276 was greater than 95% as determined by SEC-HPLC
Description

CD276 (B7-H3) functions as an immune checkpoint molecule with context-dependent co-stimulatory or co-inhibitory roles in T-cell activation, making it a target of interest in cancer immunotherapy research. This mammalian-expressed construct spanning residues 29–245 of isoform 2 captures the first two immunoglobulin-like domains, preserving the native glycosylation and folding required for authentic receptor-antibody interactions. Functional ELISA validation demonstrates specific binding to an anti-CD276 recombinant antibody with an EC50 of 47.12–54.16 ng/mL, providing quantitative evidence that this protein supports therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation assays. The combination of >95% purity and <1.0 EU/μg endotoxin meets the quality thresholds commonly required for surface plasmon resonance affinity characterization, biolayer interferometry kinetic studies, and use as a positive control in immune checkpoint binding assays.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products