Abbreviation
Recombinant Human CLEC4C protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU)，the EC50 is 7.658-12.99 ng/mL.
Alternative Names
Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL;
Species
Homo sapiens (Human)
Expression Region
45-213aa
Target Protein Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU)，the EC50 is 7.658-12.99 ng/mL.
-
CLEC4C Recombinant Monoclonal Antibody (CSB-RA855470MA1HU) captured on Protein A Chip can bind Recombinant Human CLEC4C protein with an affinity constant of 0.188 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
CLEC4C, expressed on plasmacytoid dendritic cells, functions as a pattern recognition receptor that modulates innate immune responses and represents a target for immunotherapeutic intervention in autoimmune disease and cancer. This partial construct spanning residues 45–213 captures the extracellular C-type lectin domain responsible for ligand recognition and has been validated in functional ELISA, where immobilized protein binds an anti-CLEC4C recombinant antibody with an EC50 of 7.658–12.99 ng/mL, demonstrating preserved conformational epitopes suitable for therapeutic antibody epitope mapping and blocking antibody screening. Mammalian cell expression supports native glycosylation and disulfide bond formation critical for receptor folding, enabling reliable use in ligand-binding assays, competitive inhibition studies, and affinity characterization by surface plasmon resonance or biolayer interferometry. The protein meets quality thresholds commonly required for immunology research, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, aligning with standards expected in functional binding assays and antibody validation workflows.
