Abbreviation
Recombinant Human BZW2 protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 μg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 μg/ml.
Research Area
Cell Biology
Alternative Names
Basic leucine zipper and W2 domain containing protein 2; Basic leucine zipper and W2 domain-containing protein 2; Basic leucine zipper and W2 domains 2; BZW 2; Bzw2; BZW2_HUMAN; HSPC028; MST017; MSTP017
Species
Homo sapiens (Human)
Expression Region
1-419aa
Target Protein Sequence
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time maybe differs from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 μg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 μg/ml.
Description
BZW2 functions as an eIF5-mimic protein that competes with eIF5 for ribosomal binding, positioning it as a translational regulation factor with emerging significance in cell proliferation and stress response pathways. This recombinant full-length human BZW2 (aa 1–419) carries an N-terminal GST tag and demonstrates confirmed binding activity to OMA1 in a functional ELISA, with an EC50 of 45.42–72.22 μg/ml against immobilized OMA1 at 5 μg/ml. The validated protein-protein interaction supports use in binding assays, pull-down experiments, and ELISA-based screening of interaction partners involved in mitochondrial stress signaling. Produced in *E. coli* with greater than 90% purity by SDS-PAGE, this preparation provides a suitable basis for in vitro functional studies and serves as a reliable positive control in protein interaction assays exploring BZW2's role in translational control.
