Recombinant Human Atypical chemokine receptor 1 (ACKR1) (Active)

In Stock
Code: CSB-CF624105HU
Size:
20ug
20ug100ug
US$1620
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human ACKR1 protein (Active)
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1 μg/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24 μg/ml.
Target Names
ACKR1
Uniprot NO.
Research Area
Cardiovascular
Alternative Names
ACKR1; DARC; FY; GPD; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; Fy glycoprotein; GpFy; Glycoprotein D; Plasmodium vivax receptor; CD antigen CD234
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-336aa
Target Protein Sequence
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.1 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1 μg/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24 μg/ml.
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

ACKR1 (Duffy antigen/chemokine receptor) is a seven-transmembrane receptor that presents unique challenges for recombinant production due to its multi-pass topology, and this full-length construct (aa 1–336) leverages a cell-free E. coli expression system to deliver the complete sequence—including all extracellular and transmembrane domains—without the truncation often necessitated by cell-based membrane protein expression. Functional ELISA confirms ligand-binding competence: immobilized ACKR1 at 1 μg/mL binds human CCL2 with an EC50 of 48.64–60.24 μg/mL, providing validated evidence that supports use in receptor-ligand interaction assays, competitive inhibition studies, blocking antibody screening, and therapeutic antibody epitope mapping. The N-terminal 10×His tag enables straightforward oriented capture on Ni-NTA biosensor surfaces for SPR or BLI affinity characterization of chemokine interactions or small-molecule inhibitor candidates. Purity exceeding 85% by SDS-PAGE aligns with standards expected in binding assay positive controls and early-stage drug discovery workflows targeting chemokine-mediated cardiovascular signaling.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and also for the malaria parasites P.vivax and P.knowlesi. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.
Gene References into Functions
  1. The mean number of rosettes formed by erythrocytes surrounding transfected mammalian COS-7 cells which expressed Plasmodium knowlesi Duffy binding protein differ between erythrocytes' Duffy antigen phenotypes. Plasmodium knowlesi Duffy binding protein displays higher binding to Fy(a+/b+) erythrocytes than to Fy(a+/b-) erythrocytes. PMID:30257710
  2. The atypical chemokine receptor 1 polymorphism (rs12075) does not affect susceptibility to hepatitis C virus. PMID:28443566
  3. The risk of Plasmodium vivax malaria associated with genetic variation of DARC in Thai patients is reported. PMID:29620340
  4. Our findings in mice suggest that DARC alters the severity and resolution of AHR. These findings are complimented by our human analyses in which select DARC SNPs are associated with worse asthma control and symptoms. PMID:28471517
  5. DARC expression in cancer cells inhibits pancreatic ductal adenocarcinoma progression by suppressing STAT3 activation through the inhibition of CXCR2 signaling PMID:28214673
  6. This study reports 1-3 occurrences of P. vivax infection in each of 25 Duffy-negative children at six time points over two rainy seasons and the beginning of the third season. PMID:28749772
  7. Data suggest that Type II congenital smell loss patients who exhibit both type I hyposmia and hypogeusia are genetically distinct from all other patients with Type II congenital smell loss. This distinction is based on decreased Fy(b) expression which correlated with abnormalities in two sensory modalities (hyposmia type I and hypogeusia). PMID:27968956
  8. The data suggest that selective exposure of the Duffy binding protein (DBP) binding site within DARC is key to the preferential binding of DBP to immature reticulocytes, which is the potential mechanism underlying the preferential infection of a reticulocyte subset by P vivax. PMID:28754683
  9. ACKR1 regulates neutrophil counts in blood. Lack of ACKR1 on nucleated erythroid cells together with its expression in endothelial cells causes neutropenia. PMID:28553950
  10. population genetic analysis of DARC shows its association with malaria resistance PMID:28282382
  11. Molecular identification of rare FY*Null and FY*X alleles in Caucasian thalassemic family from Sardinia. PMID:25921504
  12. We showed that DARC expression is down-regulated in CRC and associated with clinical pathological features and MVD of CRC. DARC might be involved in tumorigenesis, progression, angiogenesis, and metastasis of CRC. PMID:26096170
  13. DARC is required for Staphylococcus aureus-mediated lysis of human erythrocytes, and DARC overexpression is sufficient to render cells susceptible to toxin-mediated lysis. PMID:26320997
  14. the odds for neutropenia in the ACKR1-null (FY-) individuals were 46-fold higher than for FY+ individuals (Crude odds ratio = 46, 95% confidence interval = 8.03-263, P < 0.001) PMID:25817587
  15. study demonstrates the association of SNP rs12075 from DARC gene with the levels of serum IL8 PMID:25647274
  16. DARC levels are elevated in human keloid fibroblasts and might inhibit the secretion of CCL2. PMID:26045366
  17. Through molecular genotyping we also identified polymorphisms in RhCE, Kell, Duffy, Colton, Lutheran and Scianna loci in donors and patients. PMID:25582271
  18. The majority of our population is heterozygous for Duffy antigens a and b. PMID:24929836
  19. Duffy blood group PMID:24845979
  20. Isothermal titration calorimetry studies show these structures are part of a multi-step binding pathway, and individual point mutations of residues contacting DARC result in a complete loss of RBC binding by DBP-RII. PMID:24415938
  21. DARC polymorphisms may influence the naturally acquired inhibitory anti-Duffy binding protein II immunity PMID:24710306
  22. DARC facilitates CXCL1 inhibition of airway smooth muscle cell migration via modulation of the ERK-1/2 MAP kinase signaling pathway. PMID:24981451
  23. The Fy(a-b-) phenotype in three siblings of the Polish family was caused by the FY(*)X/FY(*)B-33 genotype. PMID:23820435
  24. DARC antigen is associated with a likelihood for patients to develop leg ulcers in sickle cell disease. PMID:23753024
  25. Effect of genetic variants in two chemokine decoy receptor genes, DARC and CCBP2, on metastatic potential of breast cancer. PMID:24260134
  26. co-expression of DARC, D6, and CCX-CKR significantly associated with higher survival in gastric cancer PMID:23462454
  27. The in fl uence of DARC gene expression on bone mineral density of the mandible was not con fi rmed. PMID:22910367
  28. DARC and BCAM expression was associated with pathogenesis of thyroid carcinoma and correlated with clinical-pathological features. PMID:23168236
  29. The high frequency of the FYES allele that silences erythroid expression of the Duffy antigen offers a biologically plausible explanation for the lack of Plasmodium vivax infections observed. PMID:23347639
  30. Although lower, the risk of Duffy-negatives to experience a P. vivax blood stage infection was not significantly different to that of Duffy-positives. PMID:23259672
  31. strong associations between SNPs in DARC gene, particularly rs12075, and serum MCP-1 levels identify a potential candidate gene that can be explored for its role in inflammatory pathways; replication of European GWAS of MCP-1 in study of Hispanic children confirms importance of DARC in regulation of MCP-1 PMID:23017229
  32. vivax malaria incidences over the past five years in an Indian population were significantly negatively and positively associated with the frequencies of the FY*A and FY*B alleles of the Duffy gene, respectively. PMID:23028857
  33. platelet molecule platelet factor 4 (PF4 or CXCL4) and the erythrocyte Duffy-antigen receptor (Fy) are necessary for platelet-mediated killing of Plasmodium falciparum parasites. PMID:23224555
  34. Data suggest that DARC (Duffy antigen receptor for chemokines) gene may play an important role in regulating the metabolisms of both lean body mass (LBM) and age at menarche (AAM). PMID:22744181
  35. We developed a phylogenetic tree for DARC alleles and postulated a distinct FY*B allele as ancestral for the extant DARC alleles in humans. PMID:22082243
  36. Our results provide evidence that the functional rs2814778 polymorphism in the gene encoding DARC is associated with worse clinical outcomes among African Americans with ALI, possibly via an increase in circulating IL-8. PMID:22207676
  37. Data show that in ancestry to the African continent (AA) subjects, the region surrounding the Duffy antigen/chemokine receptor gene (DARC) on 1q21 exhibited significant association with white blood cell count (WBC) levels. PMID:22037903
  38. findings show that Fy(a), compared with Fy(b), significantly diminishes binding of Pv Duffy binding protein (PvDBP) at the erythrocyte surface, and is associated with a reduced risk of clinical Plasmodium vivax in humans PMID:22123959
  39. It seems that this version of DARC receptor is a powerful facilitator of chemokine transcytosis and subsequently leukocyte migration into GVHD target organs. PMID:21784153
  40. Here we describe the recent success in mapping the gene that underlies benign neutropenia in African American populations. We discuss the known function of the gene and consider potential mechanisms for the effect on neutropenia.[review] PMID:22097233
  41. despite an association of CCL2 serum levels with the severity of liver fi brosis, a functional SNP in the CCL2 scavenger receptor DARC is not directly associated with the occurrence or the severity of liver disease in hepatitis C infection infection PMID:21156192
  42. DARC -46C/C results in loss of DARC expression on erthyrocytes (Duffy-null) and resistance to Plasmodium vivax malaria, and subjects with this genotype had pre-HIV seroconversion neutrophil counts of <2500 cells/mm(3). PMID:21507922
  43. DARC and D6, the most studied members of this group of molecules, are reviewed. PMID:21151196
  44. results do not support an effect of erythrocyte DARC expression on the risk or progression of prostate cancer in men of African descent. PMID:20596779
  45. This activation state associated with DARC RBC expression may influence the intensity of the inflammatory responses encountered in sickle cell anemia and participate in its interindividual clinical expression variability. PMID:21088296
  46. Duffy Antigen Receptor for Chemokines (DARC) is an unusual transmembrane chemokine receptor which binds the two main chemokine families. PMID:20655787
  47. Plasmodium vivax is able to infect and cause Malaria vivax in Duffy-negative people. PMID:20655790
  48. Results indicate that one of the primary mechanisms by which P. vivax evades host immunity is through DARC indirectly down-regulating humoral responses against erythrocytic invasion and development. PMID:20664684
  49. Genome-wide association analysis finds strong association for serum MCP-1 with a nonsynonymous polymorphism, rs12075 (Asp42Gly) in DARC. PMID:20040767
  50. Duffy-positive sickle cell anemia patients exhibited higher counts of white blood cells, polynuclear neutrophils, higher plasma levels of IL-8 and RANTES than Duffy-negative patients. PMID:20347396

Show More

Hide All

Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein. Note=Predominantly localizes to endocytic vesicles, and upon stimulation by the ligand is internalized via caveolae. Once internalized, the ligand dissociates from the receptor, and is targeted to degradation while the receptor is recycled back to the cell membrane.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Tissue Specificity
Found in adult kidney, adult spleen, bone marrow and fetal liver. In particular, it is expressed along postcapillary venules throughout the body, except in the adult liver. Erythroid cells and postcapillary venule endothelium are the principle tissues exp
Database Links

HGNC: 4035

UNIGENE: Hs.153381

KEGG: hsa:2532

STRING: 9606.ENSP00000357103

OMIM: 110700

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products