Abbreviation
Recombinant Human ACKR1 protein (Active)
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1 μg/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24 μg/ml.
Research Area
Cardiovascular
Alternative Names
ACKR1; DARC; FY; GPD; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; Fy glycoprotein; GpFy; Glycoprotein D; Plasmodium vivax receptor; CD antigen CD234
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-336aa
Target Protein Sequence
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
ACKR1 (Duffy antigen/chemokine receptor) is a seven-transmembrane receptor that presents unique challenges for recombinant production due to its multi-pass topology, and this full-length construct (aa 1–336) leverages a cell-free E. coli expression system to deliver the complete sequence—including all extracellular and transmembrane domains—without the truncation often necessitated by cell-based membrane protein expression. Functional ELISA confirms ligand-binding competence: immobilized ACKR1 at 1 μg/mL binds human CCL2 with an EC50 of 48.64–60.24 μg/mL, providing validated evidence that supports use in receptor-ligand interaction assays, competitive inhibition studies, blocking antibody screening, and therapeutic antibody epitope mapping. The N-terminal 10×His tag enables straightforward oriented capture on Ni-NTA biosensor surfaces for SPR or BLI affinity characterization of chemokine interactions or small-molecule inhibitor candidates. Purity exceeding 85% by SDS-PAGE aligns with standards expected in binding assay positive controls and early-stage drug discovery workflows targeting chemokine-mediated cardiovascular signaling.