Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

In Stock Discontinued
Code: CSB-EP008625BO-WD1
Size:
50ug
50ug1mg
US$100
Quantity:
Express system: E.coli
Species: Bos taurus (Bovine)
Tag Info: Tag free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Bovine FGF2 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤200 EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using NIH3T3 mouse embryonicfibroblast cells. The ED50 for this effect is ≤2.0 ng/mL
Target Names
bFGF/FGF-2
Uniprot NO.
Alternative Names
Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
10-155aa
Target Protein Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing 10mMPB, 250mMNaCl,5%mannitol and 0.01% Tween 80 ,pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

FGF2 orchestrates cell proliferation, survival, and differentiation across multiple lineages, making it a critical tool for dissecting mitogenic signaling and tissue regeneration pathways. This tag-free bovine ortholog, spanning the complete mature sequence (aa 10–155), demonstrates robust bioactivity with an ED50 ≤2.0 ng/mL in NIH3T3 fibroblast proliferation assays, confirming potent receptor engagement suitable for dose-response studies in stem cell expansion, neuronal differentiation protocols, and angiogenesis models. Expressed in *E. coli* to yield an unglycosylated form that retains full mitogenic function, the protein meets the purity and endotoxin criteria (>95% by SDS-PAGE; ≤200 EU/mg) typical for cell-based assays and receptor-ligand binding experiments, including ELISA and surface plasmon resonance. Researchers investigating FGF receptor specificity, wound healing mechanisms, or osteogenic differentiation will find this preparation provides a quantitatively validated basis for mechanistic and functional studies.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.
Subcellular Location
Secreted. Nucleus.
Protein Families
Heparin-binding growth factors family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products