Abbreviation
Recombinant Bovine FGF2 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤200 EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using NIH3T3 mouse embryonicfibroblast cells. The ED50 for this effect is ≤2.0 ng/mL
Alternative Names
Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
Species
Bos taurus (Bovine)
Expression Region
10-155aa
Target Protein Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing 10mMPB, 250mMNaCl,5%mannitol and 0.01% Tween 80 ,pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
FGF2 orchestrates cell proliferation, survival, and differentiation across multiple lineages, making it a critical tool for dissecting mitogenic signaling and tissue regeneration pathways. This tag-free bovine ortholog, spanning the complete mature sequence (aa 10–155), demonstrates robust bioactivity with an ED50 ≤2.0 ng/mL in NIH3T3 fibroblast proliferation assays, confirming potent receptor engagement suitable for dose-response studies in stem cell expansion, neuronal differentiation protocols, and angiogenesis models. Expressed in *E. coli* to yield an unglycosylated form that retains full mitogenic function, the protein meets the purity and endotoxin criteria (>95% by SDS-PAGE; ≤200 EU/mg) typical for cell-based assays and receptor-ligand binding experiments, including ELISA and surface plasmon resonance. Researchers investigating FGF receptor specificity, wound healing mechanisms, or osteogenic differentiation will find this preparation provides a quantitatively validated basis for mechanistic and functional studies.
