Abbreviation
Recombinant Human ICAM1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ICAM1 at 2 μg/mL can bind Anti-ICAM1 recombinant antibody (CSB-RA010949MA1HU). The EC50 is 0.2350-0.4911 ng/mL.
Alternative Names
Intercellular adhesion molecule 1; ICAM-1; Major group rhinovirus receptor; CD54; ICAM1
Species
Homo sapiens (Human)
Expression Region
28-480aa
Target Protein Sequence
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ICAM1 at 2 μg/ml can bind Anti-ICAM1 recombinant antibody (CSB-RA010949MA1HU). The EC50 is 0.2350-0.4911 ng/mL.
Description
ICAM-1 mediates leukocyte adhesion and transmigration across endothelial barriers, making it a critical target for studying immune cell trafficking, inflammatory responses, and tumor metastasis. This recombinant protein spans residues 28–480, encompassing all five immunoglobulin-like extracellular domains required for integrin binding, and demonstrates quantifiable antibody recognition with an EC50 of 0.235–0.491 ng/mL in functional ELISA, confirming proper epitope presentation. Mammalian expression ensures native glycosylation and disulfide bond formation, features that support use in cell adhesion and spreading assays, integrin-ligand binding studies, and antibody development workflows where authentic post-translational modifications are essential for physiological relevance. The protein meets the purity and endotoxin criteria typical for cell-based migration and invasion assays (>95% purity, <1.0 EU/μg), providing a suitable basis for experiments requiring direct contact with primary leukocytes or endothelial monolayers.