Recombinant Human CD58 protein (CD58), partial, Biotinylated (Active)

In Stock
Code: CSB-MP6138HUj8-B
Size:
20ug
20ug100ug1mg
US$166
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc1-avi-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CD58 protein, partial, Biotinylated (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD2(CSB-MP004894HU) at 5 μg/mL can bind Human CD58. The EC50 is 337.0-430.1 ng/mL.
Target Names
CD58
Uniprot NO.
Alternative Names
CD58 protein; CD58
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-215aa
Target Protein Sequence
FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.9 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD2(CSB-MP004894HU) at 5 μg/ml can bind Human CD58. The EC50 is 337.0-430.1 ng/mL.
  • The purity of CD58 was greater than 95% as determined by SEC-HPLC
Description

CD58 mediates T cell costimulation through its interaction with CD2, a pathway critical to immune synapse formation and tumor immune evasion mechanisms. This recombinant fragment spanning residues 29–215 demonstrates quantifiable binding to immobilized CD2 with an EC50 of 337.0–430.1 ng/mL in functional ELISA, providing a validated reagent for cell adhesion assays investigating lymphocyte-target cell interactions and for antibody development programs targeting the CD58–CD2 axis. Mammalian expression ensures native glycosylation patterns that preserve the conformational epitopes required for accurate binding kinetics in immune cell trafficking studies and tumor metastasis models. The protein meets the purity and endotoxin criteria typical for functional assays, with >95% purity by SDS-PAGE and <1.0 EU/μg endotoxin, supporting its use in cell-based migration and invasion experiments where low endotoxin levels are essential to avoid confounding inflammatory responses.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products