Recombinant Mouse Interleukin-7 (Il7) (Active)

In Stock
Code: CSB-AP004791MO
Size:
10ug
10ug50ug500ug1mg
US$290
Quantity:
Express system: Mammalian cell
Species: Mus musculus (Mouse)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Il7 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml.
Uniprot NO.
Research Area
Immunology
Alternative Names
Il7; Il-7; Interleukin-7; IL-7
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
26-154aa
Target Protein Sequence
ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Interleukin-7 is a critical regulator of T and B lymphocyte development, survival, and homeostatic proliferation, making precise recombinant forms essential for dissecting these pathways in murine models. This mammalian-expressed mouse IL-7 covers the full mature protein sequence (aa 26–154) with a C-terminal 6xHis tag, and demonstrates signaling potency with an ED50 of 60–1000 pg/ml in PHA-activated human peripheral blood lymphocyte proliferation assays. The endotoxin level of less than 1.0 EU/μg eliminates LPS-driven artifacts that confound immune cell readouts, making this protein appropriate for primary T and B cell proliferation assays, JAK/STAT signaling pathway studies, thymocyte differentiation experiments, and in vivo murine models of lymphoid reconstitution or inflammation. Purity exceeding 95% by SDS-PAGE, combined with the low endotoxin burden, also supports use as a reference standard in cytokine detection assays or as a positive control for antibody validation by ELISA.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Gene References into Functions
  1. We engineered CAR-T cells to express interleukin (IL)-7 and CCL19 (7 x 19 CAR-T cells), as these factors are essential for the maintenance of T-cell zones in lymphoid organs... Following treatment of mice with 7 x 19 CAR-T cells, both recipient conventional T cells and administered CAR-T cells generated memory responses against tumors. PMID:29505028
  2. A key role of the IL7 and Interferon type I receptor axis in the regulation of intratumoral t-cell functions and in the development of primary breast tumor growth and metastasis. PMID:29070614
  3. BMP4 and IL7 appear to be involved in the interaction between intestinal epithelial cells and intestinal epithelial cells and in the mechanism underlying intestinal mucosal barrier dysfunction. PMID:29436597
  4. This finding warrants future development of IL-21 and IL-7 co-expressing whole-cell cancer vaccines and their relevant combinatorial regimens. PMID:27571893
  5. both Flt3 ligand (FL) and IL-7 regulate B-cell commitment in a permissive manner: FL by inducing proliferation of Ly6D(+)CD135(+)CD127(+)CD19(-) progenitors and IL-7 by providing survival signals to these progenitors PMID:27911806
  6. the in vivo biological role of m(6)A modification in T-cell-mediated pathogenesis and reveals a novel mechanism of T cell homeostasis and Il-7 signal-dependent induction of mRNA degradation PMID:28792938
  7. IL-7/IL-7R signaling pathway plays a possible role in recurrent pregnancy loss by upregulating Th17 immunity while downregulating Treg immunity. PMID:27767237
  8. this study shows that IL-7 homeostasis is achieved through consumption by multiple subsets of innate and adaptive immune cells PMID:28723549
  9. lymphatic vessel expansion occurs in two distinct phases; the first wave of expansion is dependent on IL-7; the second phase, responsible for leukocyte exit from the glands, is regulated by lymphotoxin (LT)betaR signaling PMID:27474071
  10. DNM2 mutations cooperate with Lmo2 T-cell oncogenes by enhancing IL-7 signalling. PMID:27118408
  11. IL-7 responsiveness in RTE is designed to maximize survival at the expense of reduced proliferation, consistent with RTE serving as a subpopulation of T cells rich in diversity but not in frequency. PMID:27129922
  12. Expression of IL-7 is beneficial for induction of potent and long-lasting humoral immune responses. PMID:28100620
  13. findings support a redundant role for adaptive Th17 cell- and innate gammadeltaT17 cell-derived IL17 in bacteria-induced colon carcinogenesis, stressing the importance of therapeutically targeting the cytokine itself rather than its cellular sources PMID:26880802
  14. functional Gimap5 is required for optimal signaling through TCR and IL-7R in T cells. PMID:27023180
  15. continuous IL7 signaling was not required for tumor regression, although LIP of naive CD8+ T cells is usually regulated by IL7 PMID:26880265
  16. IL7 represses the follicular helper T cell gene program. PMID:26743592
  17. This study uncovers the metabolic mechanisms by which IL-7 tailors the metabolism of memory T cells to promote their longevity and fast response to rechallenge. PMID:25957683
  18. IL-7 reduced IRAK-M expression and attenuated immune tolerance induced by either LPS or CpGA PMID:26218271
  19. Poly I:C induces IL-7 production, early inflammatory responses, and characteristic pathologies of SS-like dacryoadenitis in non-autoimmune-prone C57BL/6 mice. PMID:26658504
  20. Data show that interleukin 7 (IL-7) signaling is a prerequisite for optimal CD4(+) T cell activation. PMID:26319414
  21. reduced surface expression of IL-7R and concomitant limited responsiveness to IL-7 signals as a common mechanism resulting in reduced cell survival of common lymphoid progenitors and thymocytes at the double-negative to double-positive transition PMID:26475928
  22. Hair follicle expression of IL-7 was required for CD8+ and CD4+ skin-resident memory T (TRM) cells to exert tropism for the epidermis. In a cutaneous T cell lymphoma model, CD4+ TRM lymphoma cell localization depended on hair follicle-derived IL-7. PMID:26479922
  23. Data show the contribution of IL-23/IL-23 receptor and IL-7/IL-7 receptor signaling in Th17 and Th1 cell dynamics during experimental autoimmune encephalomyelitis (EAE). PMID:26223651
  24. IL-7 plays a major role in innate immunity against Citrobacter rodentium infection. PMID:26034215
  25. The effects of 6-formylindolo (3,2-b) carbazole (Ficz), a ligand of aryl hydrocarbon receptor, on IL-7 expression, colitis and lymphocyte phenotypes are reported. PMID:25799939
  26. IL-7 critically acts cooperatively with signaling via the pre-TCR and Notch1 to coordinate proliferation, differentiation and TCRalpha recombination during beta-selection. PMID:25729925
  27. The enhanced thymic reconstitution in the rIL-7/HGFbeta-treated allogeneic BMT recipients results in increased number and functional activities of peripheral T cells. PMID:24349415
  28. these results suggest that PU.1 and Spi-B activate Btk to oppose IL-7 responsiveness in developing B cells. PMID:25505273
  29. Results provided evidence that IL-7/IL-7R induce VEGF-D upregulation and promote lymphangiogenesis via c-Fos/c-Jun pathway in lung cancer. PMID:24115038
  30. OX40 and IL-7 play synergistic, but distinct roles in the homeostatic proliferation of CD4(+) effector memory T cells PMID:25103720
  31. IL-7 holds promise as a critical cytokine for selectively inducing Tfh cell generation. PMID:24899182
  32. NF-kappaB has a role in controlling IL-7 responsiveness of quiescent naive T cells PMID:24799710
  33. IL-12 induces the expression of IL-7 in microglia and macrophages via both IL-12Rbeta2 and IL-12Rbeta1. PMID:24224652
  34. Ikaros is a central regulator of IL-7 signaling and pre-B cell development PMID:24297995
  35. our data point toward an unexpected new role for IL-7 as a potential autocrine mediator of lymphatic drainage PMID:23963040
  36. KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system. PMID:23554911
  37. -7 enhances the Th1 response to promote the development of Sjogren's syndrome-like autoimmune exocrinopathy in mice. PMID:23666710
  38. IRFs activated by lymphocyte adhesion induce IL-7 transcription through ISRE in stromal cells. PMID:23376291
  39. our results suggest that thymic epithelial cell-derived IL-7 plays a major role in proliferation, survival, and maturation of thymocytes and is indispensable for gammadelta T cell development PMID:23686483
  40. We have analyzed the discrete contributions of the antibody constant (Fc) and IL-7-binding (Fab) domains to the mechanism. PMID:23610371
  41. expression of IL-7/IL-7R is strongly correlated with rheumatoid arthritis activity and ligation of IL-7 to IL-7R contributes to monocyte homing, differentiation of osteoclasts, and vascularization in the collagen-induced arthritis effector phase. PMID:23606539
  42. IL-7 could be an important mediator in arthritic conditions PMID:22676399
  43. Cessation of the IL-7 response of pre-B cell signaling components is controlled via a cell-autonomous mechanism that operates at a discrete developmental transition marked by transient expression of c-Myc. PMID:23420891
  44. Interleukin-7, but not thymic stromal lymphopoietin, plays a key role in the T cell response to influenza A virus. PMID:23189186
  45. Interleukin-7 supports survival of T-cell receptor-beta-expressing CD4(-) CD8(-) double-negative thymocytes. PMID:23215679
  46. poly I:C boosts the T cell immune response in the lung by inducing local IL-7 production, which in turn, enhances T cell-derived IFN-gamma to promote macrophage recruitment, CXCR3 ligand expression, and T cell infiltration. PMID:23271706
  47. Data show that lymphatic endothelial cells (LECs) are a prominent source of IL-7 both in human and murine lymph nodes. PMID:22955921
  48. This is the first demonstration that high levels of IL-7 antagonize Notch-1 signaling and suggest that IL-7 may affect T- versus B-lineage choice in the thymus. PMID:22899673
  49. Although IL-7 is crucial for naive CD4+ T cell homeostatic proliferation in response to lymphopenia, it has minimal impact on the homeostatic proliferation of regulatory CD4+ (Treg) cells. PMID:22933631
  50. These observations establish a key role for IL-7 in the complex mechanisms by which immune mediators modulate metabolic functions. PMID:22768283

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-7/IL-9 family
Database Links

UNIGENE: Mm.3825

KEGG: mmu:16196

STRING: 10090.ENSMUSP00000126219

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products