Abbreviation
Recombinant Mouse Il4 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.01 ng/ml.
Alternative Names
Il4; Il-4Interleukin-4; IL-4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; BSF-1; IGG1 induction factor; Lymphocyte stimulatory factor 1
Species
Mus musculus (Mouse)
Expression Region
23-140aa
Target Protein Sequence
HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
Interleukin-4 is a pleiotropic cytokine central to Th2 polarization, B-cell class switching to IgG1, and alternative macrophage activation, making precise functional recombinants essential for dissecting these pathways. This tag-free mouse IL-4 (aa 23–140) demonstrates exceptional signaling potency with an ED50 of 0.01 ng/mL in M-NFS-60 lymphoblast proliferation assays, confirming robust engagement of the IL-4Rα/JAK-STAT6 axis at sub-picogram concentrations. Endotoxin levels below 1.0 EU/μg effectively minimize LPS-driven artifacts, which supports use in sensitive immune cell functional assays including primary B-cell differentiation, Th2 skewing of naïve CD4+ T cells, and in vivo models of allergic inflammation or helminth infection. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, also provides a suitable basis for deployment as a reference standard in IL-4 detection ELISAs or as a positive control in antibody validation workflows.