Abbreviation
Recombinant Mouse Il15ra protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is 0.5-2 ng/ml.
Alternative Names
Il15ra; Interleukin-15 receptor subunit alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA)]
Species
Mus musculus (Mouse)
Expression Region
33-205aa
Target Protein Sequence
GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
The soluble IL-15 receptor alpha subunit functions as a natural antagonist of IL-15 trans-presentation, making it a critical tool for dissecting IL-15 signaling in immunological contexts. This recombinant mouse IL-15Rα fragment (aa 33–205) demonstrates potent blocking activity with an ED50 of 0.5–2 ng/mL in inhibiting human IL-15-induced proliferation of CTLL-2 cytotoxic T cells, providing a validated positive control for competitive inhibition assays and biologic inhibitor screening. Mammalian cell expression preserves the native glycosylation and disulfide bonding of the extracellular sushi domain, ensuring conformational integrity appropriate for ligand-binding interaction studies by SPR or BLI, as well as blocking antibody screening and epitope mapping. The C-terminal Fc tag facilitates oriented capture on Protein A surfaces, while purity exceeding 90% and endotoxin levels below 1.0 EU/μg satisfy criteria typical for cell-based functional assays.