Recombinant Mouse Interleukin-15 receptor subunit alpha (Il15ra), partial (Active)

In Stock
Code: CSB-AP004801MO
Size:
10ug
10ug50ug500ug1mg
US$96
Quantity:
Express system: Mammalian cell
Species: Mus musculus (Mouse)
Tag Info: C-terminal hFc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Il15ra protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is 0.5-2 ng/ml.
Target Names
Il15ra
Uniprot NO.
Research Area
Immunology
Alternative Names
Il15ra; Interleukin-15 receptor subunit alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA)]
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
33-205aa
Target Protein Sequence
GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.5 kDa
Protein Length
Partial
Tag Info
C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

The soluble IL-15 receptor alpha subunit functions as a natural antagonist of IL-15 trans-presentation, making it a critical tool for dissecting IL-15 signaling in immunological contexts. This recombinant mouse IL-15Rα fragment (aa 33–205) demonstrates potent blocking activity with an ED50 of 0.5–2 ng/mL in inhibiting human IL-15-induced proliferation of CTLL-2 cytotoxic T cells, providing a validated positive control for competitive inhibition assays and biologic inhibitor screening. Mammalian cell expression preserves the native glycosylation and disulfide bonding of the extracellular sushi domain, ensuring conformational integrity appropriate for ligand-binding interaction studies by SPR or BLI, as well as blocking antibody screening and epitope mapping. The C-terminal Fc tag facilitates oriented capture on Protein A surfaces, while purity exceeding 90% and endotoxin levels below 1.0 EU/μg satisfy criteria typical for cell-based functional assays.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. In neutrophils, binds and activates kinase SYK in response to IL15 stimulation. In neutrophils, required for IL15-induced phagocytosis in a SYK-dependent manner.
Gene References into Functions
  1. these data support that IL15RA plays a cell-autonomous role in osteoblast function and bone mineralization PMID:28602725
  2. These data provide additional evidence to implicate IL-15Ralpha as a regulator of skeletal muscle phenotypes through effects on the mitochondrion, and suggest these effects are driven by alterations to the mitochondrial proteome. PMID:26458787
  3. Spontaneous cage activity was not different and IL-15 protein levels were lower in male and female mIl15ra(fl/fl)/Cre(+) mice. PMID:25505029
  4. Despite being protected against diet induced obesity, IL-15R alpha knockout mice are hyperglycemic and insulin-resistant. PMID:26269523
  5. Signaling through IL-15Ralpha regulates the development of gammadelta-17 cells early in ontogeny. PMID:26195801
  6. lower frequencies of IL-15Ralpha expression in PBMCs of Behcet's disease-like symptomatic mice PMID:23618691
  7. Epidermal IL-15Ralpha acts as an endogenous antagonist of psoriasiform inflammation in mouse and man. PMID:24019554
  8. a greater mitochondrial density and mitochondrial DNA content was found in fast muscles from IL-15-Receptor-alpha KO mice that was not due to the presence of smaller muscle fibers. PMID:23116661
  9. IL-15 is produced and secreted only as a heterodimer with IL-15Ralpha. PMID:22496150
  10. Stage 3 thymic invariant natural killer NKT cells are specifically reduced in IL-15Ralpha-deficient mice, whereas the acquisition of natural killer (NK) receptors occurs at stage 3 IL15-dependent thymic cell development. PMID:21709149
  11. Different levels of IL-15 trans-presentation are required for different natural killer (NK) cell developmental events to reach full maturation status PMID:21715685
  12. IL-15 receptor alpha has a role in endurance, fatigability, and metabolic characteristics of mouse fast skeletal muscles PMID:21765213
  13. The disrupted circadian rhythm of temperature and activity in the IL15Ralpha KO mice after LPS suggests that upregulated IL15 receptors may serve a beneficial role to counteract the consequences of neuroinflammation. PMID:20981579
  14. IL15 is essential to maintain neurochemical homeostasis and thereby plays a role in preventing neuropsychiatric symptoms. PMID:20724079
  15. IL15Ralpha is co-localized with co-receptor IL2Rgamma and IL-15 in neuroinflamed cerebral endothelia. PMID:21155807
  16. IL15Ralpha is essential for normal anxiety-like behavior, but inhibition of gliosis in the fearless IL15Ralpha knockout mice or IL15 treatment of normal mice did not acutely modulate behavioral performance as tested PMID:20600810
  17. T cells expressing low-avidity T cell receptors respond poorly to IL-15/IL-15Ralpha complex, which correlates with a poor homeostatic proliferative response to lymphopenia. PMID:21041729
  18. LFA-1 signal defect-induced CD8(+) T cell apoptosis is associated with reduced CD27 costimulation and IL-15R survival signal, elucidating the molecular mechanism associated with LFA-1 signaling in effector and memory CD8(+) T cell survival PMID:20569988
  19. Identified four novel IL15Ralpha splice variants in mouse cerebral microvessels composing the BBB, and showed their differential distribution and functions in endothelial signaling in response to IL15. PMID:20374432
  20. Data suggest that activation of hypothalamic neurons by IL-15 in mice contributes to thermoregulation and modifies the metabolic phenotype. PMID:20012227
  21. IL-15Ralpha(-/-) renal cells exhibited a higher rate of cisplatin-induced apoptosis PMID:19958157
  22. IL15R signaling is essential to maintain hippocampal GABA concentrations, at least partially involving reduced GABA turnover, and results in facilitation of memory consolidation. PMID:20357123
  23. Expression of soluble IL-15Ralpha (sIL-15Ralpha) mRNA declined 5-fold with age PMID:19854259
  24. Neuronal development in olfactory epithelium (OE) is inhibited by interleukin (IL)-15Ralpha deficiency because of decreased proliferative activity but not promoted apoptosis of OE cells PMID:20021484
  25. Data show that the short lifespan of T(H)17 cells was associated with small amounts of the antiapoptotic protein Bcl-2, the IL-15 receptor and the receptor CD27. PMID:19935657
  26. IL-15R alpha deficiency results in specific decreases in both the number and Bcl-2 content of CD8+ T cells. PMID:11777964
  27. Treatment with soluble interleukin-15Ralpha exacerbates intracellular parasitic infection by blocking the development of memory CD8+ T cell response. (IL-15R alpha) PMID:12045244
  28. Expression of the high-affinity receptor, IL-15R alpha, on T cells is dispensable for the generation or maintenance of memory CD8(+) T cells. By contrast, IL-15R alpha expression on cells other than T cells is absolutely critical for this function. PMID:12671073
  29. These findings demonstrate that natural killer (NK) cell-independent interleukin-15 receptor alpha (IL-15Ralpha) expression is critical for maintaining peripheral NK cells, while IL-15Ralpha expression on NK cells is not required for this function. PMID:12695489
  30. SOCS1 functions as an indispensable attenuator of IL-15 receptor signaling in developing CD8+ thymocytes PMID:12907450
  31. IL-15 receptor alpha chain expression on developing natural killer (NK) cells is not critically important for the development of CD94/NKG2+ lytic NK cells, but is required for further acquisition of Ly-49 receptors by NK cells. PMID:14607906
  32. IL-15 receptor alpha expression by murine dendritic cells is critical for natural killer (NK) cell activation and presentation of IL-15 in trans to NK cells during NK cell priming. PMID:15356102
  33. IL-15Ralpha defines homeostatic niches for NK and memory CD8+ T cells by controlling both the production and the presentation of IL-15 in trans to NK and CD8+ memory T cells PMID:15452177
  34. IL-15Ralpha can act in cis in addition to acting in trans to present IL-15 to responding cells. PMID:18796634
  35. IL-15 expression alone in TC-1 tumor cells partially inhibits tumor growth whereas IL-15 and IL-15Ralpha expression together completely inhibits tumor growth in a natural killer 1.1-positive cell- and CD8-positive T cell-dependent manner. PMID:19050240
  36. The decidual leucocytes also up-regulated IL-15 and IL-15Ralpha in stromal fibroblasts which could produce a niche for uNK cells allowing proliferation within and recruitment into the uterus. PMID:19088135
  37. Dendritic cell derived-exosomes promoted an IL-15Ralpha- and NKG2D-dependent NK cell proliferation and activation respectively, resulting in anti-metastatic effects PMID:19319200
  38. Results indicate that potential nuclear function of cleaved interleukin-2 receptor beta-chain and IL-15 receptor alpha-chain subunits is not plausible. PMID:19329337
  39. E4BP4 acted in a cell-intrinsic manner 'downstream' of the interleukin 15 receptor (IL-15R) and through the transcription factor Id2 PMID:19749763
  40. IL-15R alpha expression on macrophages but not dendritic cells (DCs) supports the early transition of antigen specific effector CD8(+) T cells to memory cells PMID:19913445

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein. Cell surface.; [Soluble interleukin-15 receptor subunit alpha]: Secreted, extracellular space.
Tissue Specificity
Widely expressed.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products