Recombinant Human Interleukin-9 (IL9) (Active)

In Stock Discontinued
Code: CSB-AP004311HU
Size:
10ug
10ug50ug500ug1mg(1mg*1 or 500ug*2)
US$290
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is typically less than 0.5 ng/ml
Uniprot NO.
Research Area
Immunology
Alternative Names
Cytokine P40; Homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; IL-9; Il9; IL9_HUMAN; Interleukin 9; Interleukin-9; Mast cell growth factor; MCGF; Megakaryoblast growth factor; P40; p40 cytokine; p40 T cell and mast cell growth factor ; T cell growth factor 3 ; T cell growth factor p40 ; T-cell growth factor P40; TCGF 3
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-144aa
Target Protein Sequence
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.16 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Supports IL-2 independent and IL-4 independent growth of helper T-cells.
Gene References into Functions
  1. this study shows that intensified IL-9 production is associated with the immunopathogenesis of active ulcerative colitis PMID:29927662
  2. IL9 CNS-25/IL9 CNS-18 is a critical and conserved regulatory element for IL-9 production in mice and humans. PMID:30442929
  3. CXCL10, not CXCL9 or CXCL11, induced IL-9 expression in the liver tissue. PMID:29860220
  4. Our study reveals that degeneration and destruction of cartilage may be related to the production of IL-9 in osteonecrosis of the femoral head patients. In a human primary chondrocytes culture model, IL-9 increased the degeneration of cartilage; blocking JAK-STAT signaling alleviated this effect. PMID:29775946
  5. Having one or more copies of the 1635A allele was associated with increased cytomegalovirus acquisition in HIV-infected infants (42 vs. 11%, P = 0.03) and increased risk of Epstein-Barr virus acquisition in HIV-exposed uninfected infants (hazard ratio = 4.2, P = 0.02) compared with 1635GG. PMID:29112074
  6. T Helper 9 cells may be the major source of interleukin-9 (IL-9) in children with allergic asthma. In these patients, IL-9 impairs interferon gamma production and synergistically promotes interleukin-4-induced IgE secretion. PMID:28724400
  7. Increased expression of nuclear factor of activated T cells 1 drives IL-9-mediated allergic asthma. PMID:26993036
  8. these results demonstrated that IL-9-expressing Th9 cells were upregulated in breast cancer patients and potentially possessed antitumor roles by enhancing CD8+ T cell-mediated cytotoxicity PMID:28918288
  9. Serum IL-9 and IL-22 are associated with eosinophilia in cow's milk allergy, and decrease in these two cytokines with occurs with cow's milk elimination. PMID:28934137
  10. The systemic IL9 level is higher in ulcerative colitis and corresponds with endoscopic inflammation, suggesting its possible application as a negative marker of mucosal healing. PMID:28652656
  11. These findings suggest that IL-9 is involved in the pathogenesis of VKH disease, and that IL-9 might also enhance the inflammatory response by increasing the secretion of IL-17, an established proinflammatory cytokine in VKH disease PMID:28761327
  12. Data suggest that the conditions defined for strong induction of interleukin-9 (IL-9) might be relevant for the development of Vdelta2 T-cell-based immunotherapy. IL-9 might be relevant for the development of Vdelta2 T-cell-based immunotherapy. PMID:27791087
  13. An aberrant expression profile of Th9/IL-9 was associated with pathogenesis of immune thrombocytopenia, possibly through cooperative interaction with Th17/IL-17. PMID:27662073
  14. In vitro data indicate that IL9 is regulated by STAT3/5 and in vivo results highlight the pro-neoplastic effect of IL9 on lymphoma T cells. The results suggest that IL9 and its regulators are promising new targets for therapy development in mycosis fungoides. PMID:26851186
  15. recent findings suggest that blockade of IL-9 signaling is effective in treating experimental models of autoimmune and chronic inflammatory diseases such as inflammatory bowel diseases, allergic disorders such as food allergy and asthma. PMID:26976761
  16. Findings showed that serum levels of IL-9 were elevated in diffuse large-B-cell lymphoma (DLBCL) patients and positive expression of IL-9 was correlated with adverse prognosis indicators. It directly effected proliferation and apoptosis of DLBCL cells by enhancing the expression of p21CIP1 genes and promoted tumor cells to display resistance to chemotherapeutic drugs. PMID:27364124
  17. no differences were found in serum levels of IL-9 between different clinical forms of periportal fibrosis in human Schistosoma mansoni infection in Brazil PMID:27506138
  18. PU.1 and IL-9 may play a role in AD pathogenesis and relate to disease severity and clinical eruption types. PMID:28229452
  19. Inflammatory cell expression of IL-9 and IL-17C were increased in chronic rhinosinusitis, particularly with allergy and asthma. These interleukins may contribute to the pathogenesis of chronic rhinosinusitis with nasal polyps as well as atopy and may serve as therapeutic targets for disease management PMID:26989880
  20. serum levels determined of both T cell polarizing (IL- 33 and IL-12) and T cell effector (IFN-gamma, IL-4, IL-10, IL-17 and IL-9) cytokines in T1DM (type-1 Diabetes Mellitus) subjects with and without microvascular complications (MVC). All the tested cytokines were significantly elevated in T1DM subjects except for IFN-gamma with no significant difference between those with and without MVC. PMID:27442004
  21. results suggest that Th9 cells and IL-9 could play an important role in the pathogenesis of systemic sclerosis by modulating adaptive and innate immune responses and the production of autoantibodies and indicate the IL-9 pathway as a possible therapeutic target PMID:28681919
  22. TL1A differentially induces expression of TH17 effector cytokines IL-17, -9, and -22 and provides a potential target for therapeutic intervention in TH17-driven chronic inflammatory diseases. PMID:27733581
  23. These data indicate that IL-9 is an essential regulator of megakaryopoiesis and a promising therapeutic agent for treatment of thrombocytopenia such as CIT. PMID:28450306
  24. Expression of IL-9 remarkably increases in peripheral blood and liver tissues in patients with primary biliary cirrhosis PMID:27916102
  25. IL-9 promotes proliferation and metastasis in pancreatic cancer cells; this effect may partly involve regulation of the miR-200a/b-catenin axis. PMID:28349057
  26. in PsA patients gammadelta T cells activation is driven prevalently by IL-9/IL-9R interaction, and not only by IL-23/IL-23R. Together these findings indicate gammadelta T cells and IL-9 as new players in the pathogenesis of PsA. PMID:27543964
  27. Th9 cells produce IL9 that may participate in pathogenesis of Takayasu's arteritis PMID:27629397
  28. IL-9 serum leves are elevated in patients with systemic lupus erythematosus, rheumatoid arthritis and systemic sclerosis but their clinical significance is unknown. [review] PMID:26921642
  29. Th9 cell numbers and IL-9 levels are correlated with OA patient symptoms and joint functionality PMID:26926842
  30. IL-9 is functionally active, and is a pro-growth/survival factor for the localized pathologic T cells in the synovium of inflammatory arthritis. PMID:26751012
  31. Asthmatic children showed an increase in plasma Il9 levels post Mycoplasma pneumoniae infection. PMID:26191227
  32. Interleukin-9 Is Associated with Elevated Anti-Double-Stranded DNA Antibodies in Lupus-Prone Mice PMID:25902303
  33. Data demonstrated increased serum levels of IL-9 in systemic lupus erythematosus and rheumatoid arthritis patients but no association with clinical and laboratory parameters was found. PMID:26078482
  34. identified as a gene target that might interact with environmental exposure to dust mite allergen to increase asthma severity in children PMID:25913104
  35. association between IL-9 and diabetic kidney disease was complex as it was reduced in diabetes mellitus, but it was of normal levels in those with diabetic kidney disease PMID:25542095
  36. secretion increased in respiratory epithelial adenomatoid hamartoma tissue PMID:26131817
  37. The results provide evidence that IL-9 is predominantly involved in the pathogenesis of ulcerative colitis suggesting that targeting IL-9 might become a therapeutic option for patients with UC. PMID:24957265
  38. Serum IL-9 is closely related to several clinical features, such as age, B symptoms and local lymph node involvement. It can also be an independent prognostic factor for extranodal NK/T-cell lymphoma, which suggests a role for IL-9 in disease pathogenesis PMID:24722378
  39. Upregulation of IL-9 induced by pSTAT6 may be involved in the pathogenesis of chronic lymphocytic leukemia. PMID:24966942
  40. IL-9 is a key component of memory TH cell peanut-specific responses from children with peanut allergy (PA) and may be a useful biomarker to distinguish between children with PA and those with peanut sensitization. PMID:25112699
  41. Overexpression of IL-9 may contribute to the pathogenesis of chronic lymphocytic leukemia and is associated with some adverse prognostic parameters. PMID:24551294
  42. This study demonstrates that IL-9, through its direct effects on Th1 and ability to promote IL-4 secretion, has a regulatory role for Th1 lymphocytes in allergic contact dermatitis. PMID:24487305
  43. A role for the IL-9/IL-9R axis in the atherosclerotic process, is reported. PMID:24023645
  44. IL-9 production by memory T-helper (TH)9 cells is higher in the peripheral blood of patients with asthma than in healthy donors. PMID:24468256
  45. Recruitment of interleukin 9-producing CD4+ T cells into malignant pleural effusion could be induced by pleural CCL20 and that the majority of Th9 cells in MPE displayed the phenotype of effector memory cells. PMID:23700286
  46. The activator protein 1 (AP1) family transcription factor BATF (B cell, activating transcription factor-like) was among the genes enriched in Th9 cells and was required for the expression of IL-9 and other Th9-associated genes. PMID:24216482
  47. the expansion of the Th9 cell subset, up-regulation of the PU.1 transcription factor and increased secretion of the IL-9 cytokine may contribute to the pathogenesis of AD PMID:24032555
  48. Higher numbers of TH9 cells occur in normal human skin & blood vs metastatic lesions of progressive stage IV melanoma. These results suggest a role for IL-9 in tumor immunity. PMID:22772464
  49. Children with atopic dermatitis may have higher serum IL-9 levels than healthy children, and IL-9 levels are significantly related to symptom severity. PMID:22612419
  50. Substantial renal IL-9 release was observed from deceased donor kidneys PMID:22971662

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-7/IL-9 family
Database Links

HGNC: 6029

UNIGENE: Hs.960

KEGG: hsa:3578

STRING: 9606.ENSP00000274520

OMIM: 146931

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products