Recombinant Human Interleukin-17F (IL17F) (Active)

In Stock
Code: CSB-AP004461HU
Size:
10ug
10ug50ug500ug1mg
US$204
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human IL17F protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17RA-Fc at 1μg/ml can bind Human IL-17F-His, the ED50 of Human IL-17F-His is 47.94 ng/ml.
Target Names
IL17F
Uniprot NO.
Research Area
Immunology
Alternative Names
CANDF6; Cytokine ML 1; Cytokine ML-1; IL 17F; IL 24; IL-17F; IL-24; Il17f; IL17F_HUMAN; Interleukin 17F; Interleukin 24; Interleukin-17F; Interleukin-24; ML 1; ML1; Mutant IL 17F; OTTHUMP00000016602
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-163aa
Target Protein Sequence
RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.96 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

IL-17F plays a central role in mucosal immunity and inflammatory tissue remodeling, making precise functional characterization essential for studies of Th17-driven pathology. This recombinant human IL-17F encompasses the full mature protein (aa 31–163), expressed in mammalian cells with a C-terminal 6xHis tag, and demonstrates confirmed binding to immobilized mouse IL-17RA-Fc with an ED50 of 47.94 ng/ml in functional ELISA—validating its suitability as a coating antigen for antibody screening, a positive control in cytokine detection assays, and a ligand in receptor-binding studies. The endotoxin level below 1.0 EU/μg minimizes LPS-driven artifacts in cell-based assays examining NF-κB or MAPK activation downstream of IL-17RA engagement, and supports use in primary cell stimulation experiments or in vivo inflammation models where innate immune confounders must be excluded. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, provides a suitable basis for quantitative signaling pathway dissection and antibody development workflows.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products