Home
Product
Protein
Active Protein
Interleukin
Recombinant Human IL17A & IL17F Heterodimer Protein (Active)

Recombinant Human IL17A & IL17F Heterodimer Protein (Active)

In Stock

Code: CSB-AP004701HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg

US$290

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human IL17A&IL17F Heterodimer protein (Active)

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

①Loaded Biotinylated Human IL-17RA -His-Avi on SA Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 8.6 pM as determined in BLI assay.②Loaded Biotinylated Human IL-17RA-Fc on Pro A Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 10.3 nM as determined in BLI assay.

Uniprot NO.

Q16552&AAH70124.1

Research Area

Immunology

Alternative Names

CTLA 8; CTLA-8; CTLA8; cytotoxic T lymphocyte associated antigen 8; Cytotoxic T lymphocyte associated protein 8; Cytotoxic T lymphocyte associated serine esterase 8; Cytotoxic T-lymphocyte-associated antigen 8; IL 17; IL 17A; IL-17; IL-17A; IL17; IL17_HUMAN; Il17a; Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin 17A; Interleukin-17A; interleukin17; Interleukin17A; OTTHUMP00000016597; OTTMUSP00000046003

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

24-155aa & 31-163aa

Target Protein Sequence

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA &RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

15.1kDa & 16.0 kDa

Protein Length

Heterodimer

Tag Info

C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

The IL-17A/F heterodimer plays a distinct role in mucosal immunity and inflammatory signaling, bridging IL-17A and IL-17F homodimer activities through preferential engagement of the IL-17RA/RC receptor complex. This recombinant human IL-17A&IL-17F heterodimer (aa 24–155 of IL-17A & aa 31–163 of IL-17F, C-terminal 6×His-tagged) demonstrates picomolar affinity for IL-17RA (KD = 8.6 pM by BLI), confirming native-like receptor engagement suitable for NF-κB and MAPK signaling pathway studies, cell-based activation assays in synoviocytes or epithelial cells, and antibody development campaigns requiring a physiologically relevant coating antigen. The protein also binds IL-17RA-Fc with a KD of 10.3 nM, supporting its use as a reference standard in receptor-binding inhibition assays and neutralization screening. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for in vivo inflammation models and primary immune cell experiments where LPS-driven artifacts must be excluded.