Home
Product
Protein
Active Protein
Interleukin
Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active)

Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active)

In Stock

Code: CSB-AP004551HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg

US$290

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal hFc-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human IL15RA protein, partial (Active)

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is 0.35-3.5 ng/ml.

Uniprot NO.

Q13261-3

Research Area

Immunology

Alternative Names

AA690181; CD215; I15RA_HUMAN; IL 15R alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; Il15ra; Interleukin 15 receptor alpha ; Interleukin 15 receptor subunit alpha; MGC104179; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA; Soluble interleukin 15 receptor subunit alpha; Soluble interleukin-15 receptor subunit alpha

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

31-172aa

Target Protein Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIKPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

42.2 kDa

Protein Length

Partial of Isoform 2

Tag Info

C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

IL-15 signaling drives NK cell and memory CD8+ T cell homeostasis, and this recombinant human IL15RA fragment (aa 31–172 of Isoform 2) provides the extracellular sushi domain responsible for high-affinity IL-15 binding, enabling precise interrogation of receptor-ligand interactions. Functional validation confirms an ED50 of 0.35–3.5 ng/mL in blocking IL-15-induced CTLL-2 proliferation, directly supporting use in competitive inhibition assays, blocking antibody screening, and biologic inhibitor discovery campaigns. Mammalian cell expression preserves native glycosylation and disulfide-mediated folding critical for conformational integrity, making this C-terminal Fc-tagged construct appropriate for SPR- or BLI-based affinity characterization, ELISA-format ligand-binding studies, and therapeutic antibody epitope mapping. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and sensitive biophysical measurements.