Recombinant Human Interleukin-13 (IL13) (Active)

In Stock

Code: CSB-AP004321HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg

US$290

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human IL13 protein, partial (Active)

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 0.01 EU/µg as determined by LAL method.

Activity

The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 1.5-4.5 ng/ml.

Target Names

IL13

Uniprot NO.

AAH96139

Research Area

Immunology

Alternative Names

Allergic rhinitis; ALRH; BHR 1; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; IL-13; Il13; IL13_HUMAN; Interleukin 13; Interleukin-13; interleukin13; MGC116786; MGC116788; MGC116789; NC 30; NC30; P 600; P600

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

35-146aa

Target Protein Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered PBS,PH7.4

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

IL-13 drives Th2-polarized immune responses and plays a central role in allergic inflammation, fibrosis, and alternative macrophage activation, making precise functional studies of this cytokine essential for immunology research. This recombinant human IL-13 (residues 35–146) carries a C-terminal 6xHis tag and demonstrates robust signaling potency with an ED50 of 1.5–4.5 ng/mL in TF-1 cell proliferation assays, confirming its suitability for cell-based functional studies including JAK/STAT6 pathway activation, B-cell differentiation, and macrophage polarization experiments. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts that can confound immune cell readouts, supporting use in sensitive in vivo inflammation models and as a reference standard in cytokine detection assays. Mammalian-expressed to preserve native folding and post-translational modifications, this protein provides greater than 95% purity and aligns with standards expected in antibody development workflows such as ELISA coating or positive control applications.