Abbreviation
Recombinant Mouse Il33 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-33 at 5μg/ml can bind Mouse ST2-Fc, the ED50 of Mouse ST2-Fc is 0.33 ug/ml.
Alternative Names
Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11
Species
Mus musculus (Mouse)
Expression Region
109-266aa
Target Protein Sequence
SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 1mM DTT, pH 7.4.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
Interleukin-33 drives type 2 immune responses by engaging the ST2 receptor to activate NF-κB and MAPK signaling cascades in ILC2s, mast cells, and Th2 lymphocytes. This tag-free recombinant mouse IL-33 encompasses the mature cytokine domain (aa 109–266), preserving the full receptor-binding region required for faithful ST2-dependent signaling, and demonstrates confirmed binding activity with an ED50 of 0.33 µg/mL for mouse ST2-Fc in functional ELISA. The endotoxin level of less than 1.0 EU/µg minimizes LPS-driven artifacts, which supports use in sensitive cell-based assays such as mast cell activation, ILC2 proliferation, and Th2 differentiation, as well as in vivo murine models of allergic airway inflammation or tissue repair. Purity exceeding 95% by SDS-PAGE, combined with validated ST2 binding, provides a suitable basis for antibody development workflows, ELISA coating antigen applications, and reference standard use in cytokine detection assays.