Home
Product
Protein
Active Protein
Immune Checkpoint
Recombinant Human T-lymphocyte activation antigen CD86 (CD86), partial (Active)

Recombinant Human T-lymphocyte activation antigen CD86 (CD86), partial (Active)

In Stock

Code: CSB-AP005161HU

Rate （5.0）
Review （1）
Citation （1）

Size:

10ug50ug500ug1mg

US$96

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human CD86 protein, partial (Active)

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human CTLA-4-Fc-Avi at 5μg/ml can bind Human B7-2-His, the ED50 of Recombinant Human B7-2-His is 1.19 μg/ml.

Uniprot NO.

AAH40261.1

Research Area

Immunology

Alternative Names

CD86; CD28LG2; T-lymphocyte activation antigen CD86; Activation B7-2 antigen; B70; BU63; CTLA-4 counter-receptor B7.2; FUN-1; CD antigen CD86

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

24-247aa

Target Protein Sequence

APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26.69 kDa

Protein Length

Extracellular Domain

Tag Info

C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

CD86 serves as a critical costimulatory ligand in immune checkpoint signaling, engaging both CD28 and CTLA-4 to regulate T-cell activation and tolerance. This recombinant human CD86 extracellular domain (aa 24–247) demonstrates confirmed binding to CTLA-4-Fc with an ED50 of 1.19 μg/ml in functional ELISA, providing a suitable basis for receptor-ligand interaction assays, competitive inhibition studies, and blocking antibody screening in checkpoint immunology research. Mammalian cell expression preserves native glycosylation and conformational integrity of the IgV and IgC domains, which supports reliable performance in SPR- or BLI-based affinity characterization, therapeutic antibody epitope mapping, and small-molecule inhibitor screening targeting the CTLA-4/CD86 axis. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based costimulation assays and as a positive control in binding experiments.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : As control proteins

Review: To verify the specificity of the sensor for CEA detection, control experiments were carried out by using BSA, PSA, CD86 and EpCAM as control proteins. As shown in Fig. 4C, an obvious current was obtained in buffer containing CEA while only negligible currents were obtained in control groups containing BSA, PSA, CD86 and EpCAM even at a 10-fold concentration of CEA, indicating the specificity of the sensor.

By Anonymous