Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 200 ng/ml.
Alternative Names
Antigen identified by monoclonal 1D8; Antigenic surface determinant protein OA3; CD 47; CD47; CD47 antigen (Rh-related antigen; integrin-associated signal transducer); CD47 antigen; CD47 glycoprotein; CD47 molecule; CD47_HUMAN; IAP; Integrin Associated Protein; Integrin associated signal transducer; Integrin-associated protein; Leukocyte surface antigen CD47; MER 6; MER6; OA 3; OA3; OTTHUMP00000041152; OTTHUMP00000041153; Protein MER6; Rh related antigen; Surface antigen identified by monoclonal 1D8
Species
Homo sapiens (Human)
Expression Region
19-139aa
Target Protein Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4.
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.