Abbreviation
Recombinant Human CD47 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Loaded Anti-Human CD47 mAb-Fc on Protein A Biosensor, can bind Human CD47-His with an affinity constant of 0.22 nM as determined in BLI assay.
Alternative Names
Antigen identified by monoclonal 1D8; Antigenic surface determinant protein OA3; CD 47; CD47; CD47 antigen (Rh-related antigen; integrin-associated signal transducer); CD47 antigen; CD47 glycoprotein; CD47 molecule; CD47_HUMAN; IAP; Integrin Associated Protein; Integrin associated signal transducer; Integrin-associated protein; Leukocyte surface antigen CD47; MER 6; MER6; OA 3; OA3; OTTHUMP00000041152; OTTHUMP00000041153; Protein MER6; Rh related antigen; Surface antigen identified by monoclonal 1D8
Species
Homo sapiens (Human)
Expression Region
19-139aa
Target Protein Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
CD47 functions as a critical "don't eat me" signal through its interaction with SIRPα, making it a high-value immune checkpoint target in immuno-oncology research. This recombinant human CD47 encompasses the extracellular IgV-like domain (aa 19–139), expressed in mammalian cells to preserve native glycosylation and disulfide-mediated folding essential for proper receptor-ligand engagement. BLI validation demonstrates that the protein binds an anti-human CD47 mAb-Fc with a KD of 0.22 nM, confirming conformational integrity suitable for therapeutic antibody epitope mapping, competitive blocking antibody screening, and affinity characterization by SPR or BLI. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this C-terminal His-tagged construct meets the quality thresholds commonly required for cell-based immune checkpoint assays, small-molecule inhibitor screening, and SIRPα–CD47 interaction studies by ELISA or biosensor platforms.