Recombinant Rat Fibroblast growth factor 2 (Fgf2), partial (Active)

In Stock
Code: CSB-AP004171RA
Size:
10ug
10ug50ug500ug1mg
US$204
Quantity:
Express system: E.coli
Species: Rattus norvegicus (Rat)
Tag Info: Tag-Free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Rat Fgf2 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 0.3-1.8 ng/ml.
Target Names
Fgf2
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
Fgf2; Fgf-2Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
11-154aa
Target Protein Sequence
ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.2 kDa
Protein Length
Partial
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

FGF-2 is a potent mitogen central to angiogenesis, wound healing, and stem cell maintenance, and this rat recombinant form (residues 11–154) demonstrates strong receptor-binding potency with an ED50 of 0.3–1.8 ng/mL in Balb/3T3 fibroblast proliferation assays. Because native FGF-2 is non-glycosylated, E. coli expression yields a tag-free protein that is functionally equivalent to the endogenous ligand, making it appropriate for receptor-ligand binding studies via SPR or ELISA, neural and osteogenic differentiation protocols, and in vivo angiogenesis or wound healing models. Endotoxin levels below 1.0 EU/μg combined with greater than 95% purity by SDS-PAGE satisfy the criteria typical for sensitive cell-based proliferation assays and long-term stem cell culture without confounding inflammatory artifacts.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.
Gene References into Functions
  1. Dual delivery of bFGF and NGF binding coacervate was neuroprotective via stimulating the growth and proliferation of neurons. PMID:29895019
  2. FGF2 protects against renal ischemia-reperfusion injury by attenuating mitochondrial damage and proinflammatory signaling. PMID:28544332
  3. Study shows that fibroblast growth factor 2-ERK1/2 pathway is involved in the pathophysiology of depressive-like behaviors, and manipulating the neurogenesis pathway is a viable therapeutic approach to inflammation-associated depression. PMID:28529071
  4. These findings may offer insight to help us understand more as to how bFGF ASODN can effectively suppress the proliferation and differentiation of NSCs. PMID:28390174
  5. the present findings demonstrate that OCT alone or in combination with bFGF accelerates nerve repair in a large peripheral nerve defect in rats. PMID:27529414
  6. Effect of basic fibroblast growth factor released from chitosan-fucoidan nanoparticles on neurite extension PMID:23696519
  7. Thus, FGF2 is an alcohol-responsive gene constituting a positive regulatory feedback loop with alcohol. This loop leads to facilitation of alcohol consumption, marking FGF2 as a potential new therapeutic target for alcohol addiction. PMID:28821667
  8. attempted to identify PKGII-targeted proteins, which are associated with the inhibition of FGF2-induced MAPK activation PMID:28057484
  9. a moderate level of FGF-2 expression was observed in the cells within the connective tissue of the healing wounds of the normoglycemic group on all days evaluated which differed from that observed in the wounds of the diabetic group PMID:27188585
  10. overexpression of BNIP3L in H9C2 cardiomyoblast cells reduced the cardioprotection of FGF-2 in hydrogen peroxide-induced necrosis and mitochondrial dysfunction. PMID:28006775
  11. The induction of active beta-catenin and then fibronectin turnover in response to bFGF were markedly increased in pulmonary fibroblasts from rat with COPD. beta-Catenin/RhoA pathway results in ECM deposition in lung fibroblasts and myofibroblasts differentiation. PMID:27734223
  12. It plays an important role as a key trigger of Intramuscular adipose tissue formation in vivo. PMID:26154243
  13. This study demonstrated that altered Cx43 expression modulates bFGF expression, which correlates with prolactinoma development. PMID:27078698
  14. Basic fibroblast growth factor increased in spinal microglia during the development of allodynia after spinal nerve ligation. PMID:26583471
  15. TGF-beta1 was upregulated with FGF-2 treatment, and alpha-SMA expression induced by FGF-2 was inhibited after the cell was transferred with TGF-beta1 siRNA. PMID:26729053
  16. Apocynin attenuated cardiac injury in type 4 radiorenal syndrome rats via inhibiting NADPH oxidase-dependent oxidative stress-activated ERK1/2 pathway and subsequent FGF-2 upregulation. PMID:26109504
  17. Astrocyte-secreted FGF2 mediated stress-hormone-induced neural stem cell proliferation. PMID:23599891
  18. Basic fibroblast growth factor and neurotrophin-3, which are released from astrocytes by exposure to thyroid hormone, influence each other to enhance Na+ current density in cultured hippocampal neurons. PMID:26009773
  19. GK-2 had no effect on the expression level of FGFb and NT4, however, promoted an increase in the expression level of BDNF. PMID:26571801
  20. FGF-2 in dissociated postnatal retinal cell cultures and found that FGF-2 is a potent factor triggering ganglion cell differentiation PMID:25402196
  21. Regional differences in the FGF-2 expression pattern as either the first or the second injection of cocaine by themselves upregulated FGF-2 mRNA in the medial prefrontal cortex and nucleus accumbens while downregulating it in the hippocampus. PMID:25124315
  22. fibroblast growth factor 2has roles in maintenance of the undifferentiated state and in proliferation of Endothelial progenitor cells , allowing EPC to maintain the potential to differentiate to Endothelial Cells. PMID:24694617
  23. Subsarcolemmal mitochondria are more responsive than interfibrillar mitochondria to FGF-2-triggered protection from calcium-induced permeability transition, by a Cx43 channel-mediated pathway. PMID:24654232
  24. It was found that cultivation of the cells under hypoxic conditions and bFGF is an optimum to maintain high viability and proliferation capacity of the mesenchymal stem cells. PMID:25715620
  25. The learning impairment in IL-1beta-treated rats is accompanied by lower FGF-2 mRNA levels in medial prefrontal cortex and ventral (not dorsal) hippocampus, but TIMP-1 was not affected. PMID:25697011
  26. astroglial cell maturation is enhanced by bFGF through induction of miR-134 PMID:25482448
  27. bFGF-induced differentiation of dorsal root ganglia stem cells toward Schwann cells might be mediated by binding to fibroblast growth factor receptor-1 (FGFR-1) through activation of MAPK/ERK signal pathway. PMID:24072480
  28. It is one of the key players in the origin and growth of neuronal and glial cells through autocrine and paracrine signaling. PMID:24707873
  29. implicate FGF2 as a modifier of epigenetic mechanisms associated with emotional responsiveness, and point to H3K9me3 as a key player in the regulation of affective vulnerability PMID:25071177
  30. enhanced protein kinase C levels, reduction of basic FGF expression, and increased in apoptosis might be associated with the development of diabetes-induced myoatrophy PMID:24008114
  31. Studied the change of FGF-2 and IGF-1 in serum and bone callus after fracture in diabetic rats, and explored molecular biological mechanism of healing of diabetic fracture. PMID:24418087
  32. TGF-beta1 and FGF2 induce the epithelial-mesenchymal transition of Hertwig's epithelial root sheath through a MAPK/ERK-dependent signaling pathway. PMID:24610459
  33. Following FGF2 treatment, however, bHR-bLR differences in CCK and FGF-R1 mRNA expression were eliminated, due to decreased CCK mRNA levels PMID:24121132
  34. Retinal injury may enhance neurotrophic factor expression in mesenchymal stem cells and promote the repair process. PMID:24030359
  35. matrix proteoglycans such as perlecan serve as functional docking platforms for FGF2 in chronic transplant dysfunction. PMID:24035513
  36. Basic fibroblast growth factor contributes to a shift in the angioregulatory activity of retinal glial (Muller) cells. PMID:23861940
  37. With an increase in the degree of pressure ulcers, the expression of VEGF and bFGF in pressure ulcers tissue are decreased. This leads to a reduction in angiogenesis and may be a crucial factor in the formation of pressure ulcers. PMID:23740668
  38. This study provides evidence that E and FGF2 exert a cooperative effect on the lactotroph proliferation principally by signaling initiated at the plasma membrane. PMID:23651845
  39. Psychological stress could delay periodontitis healing in rats, which may be partly mediated by downregulation of the expression of bFGF in the periodontal ligament. PMID:23326020
  40. We conclude that FGF-2 secreted by bone marrow-derived cells strongly increases early glial proliferation, which can potentially improve peripheral nervous system regeneration. PMID:22793996
  41. FGF-2 induced the phosphorylation of Akt and its substrate, glycogen synthase kinase 3beta (GSK3beta) in addition to three MAP kinases in rat glioma cells. PMID:22575563
  42. Spinal cord treatment of lesion with sciatic nerve and sciatic nerve plus FGF-2 allows recovery of hind limb movements compared to control, manifested by significantly higher behavioral scores after surgery. PMID:22555431
  43. Inhibitng bFGF alleviates bleomycin-induced pulmonary fibrosis in rats. PMID:20684286
  44. bFGF promote the proliferation and migration of endothelial progenitor cells, the effects of bFGF being implemented by activating ERK signalling through the expression of Pdgfrb. PMID:22731705
  45. The epithelial and smooth muscle cell hyperplasia and increased Fgf-2 expression observed in this experimental model of obesity/insulin-resistance might explain the high frequency of benign prostatic hyperplasia in insulin-resistant men. PMID:22661309
  46. bFGF gene expression is elevated following cerebral concussion, and might play an important role in cell degeneration and necrosis. PMID:12857442
  47. Data suggest that molecular mechanism of dihydrotestosterone induction of Pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4) during spermatogenesis involves stimulation of Sertoli cells to secrete FGF-2. PMID:22811469
  48. FGF-2 gene expression is significantly elevated from day 1 to day 14; the increase in FGF-2 protein level is most evident at day 7; cells expressing FGF-2 are primarily endothelial cells following myocardial infarction. PMID:20674996
  49. The expression of VEGF and bFGF is significantly increased after stromal cell transplantation therapy during the late phase of acute myocardial infarction. PMID:21162206
  50. astrocyte migration to injury sites may be a key factor in the repair mechanisms orchestrated by FGF2. PMID:22189091

Show More

Hide All

Subcellular Location
Secreted. Nucleus.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Found in all tissues examined.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products